BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50990 CN[C@@H](C)C(=O)N[C@H](C(=O)N1CC[C@H]2CC[C@H](NC(=O)C(c3ccccc3)c3ccccc3)[C@@H]12)C(C)(C)C InChI=1S/C31H42N4O3/c1-20(32-5)28(36)34-27(31(2,3)4)30(38)35-19-18-23-16-17-24(26(23)35)33-29(37)25(21-12-8-6-9-13-21)22-14-10-7-11-15-22/h6-15,20,23-27,32H,16-19H2,1-5H3,(H,33,37)(H,34,36) BGWQMUKSEXDJIL-UHFFFAOYSA-N 27918 (2S)-N-[(2S)-1-[(3aR,6S,6aS)-6-(2,2-diphenylacetamido)-octahydrocyclopenta[b]pyrrol-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::Azabicyclooctane scaffold, 14a Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 82 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27918 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27918&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25195345 57560430 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 50991 C[C@@H](C(=O)N[C@H](C(=O)N1CC[C@@H]2[C@H]1[C@H](CC2)NC(=O)c3cccc4c3cccc4)C(C)(C)C)NC InChI=1S/C28H38N4O3/c1-17(29-5)25(33)31-24(28(2,3)4)27(35)32-16-15-19-13-14-22(23(19)32)30-26(34)21-12-8-10-18-9-6-7-11-20(18)21/h6-12,17,19,22-24,29H,13-16H2,1-5H3,(H,30,34)(H,31,33) FTXKVJPIFDKIID-UHFFFAOYSA-N 27919 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]naphthalene-1-carboxamide::Azabicyclooctane scaffold, 14b Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 46 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27919 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27919&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search G13 3F7I 25195346 57560431 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 50992 [H][C@]12CC[C@H](NC(=O)c3ccc(F)c4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C28H37FN4O3/c1-16(30-5)25(34)32-24(28(2,3)4)27(36)33-15-14-17-10-13-22(23(17)33)31-26(35)20-11-12-21(29)19-9-7-6-8-18(19)20/h6-9,11-12,16-17,22-24,30H,10,13-15H2,1-5H3,(H,31,35)(H,32,34) YAJNIUXPYCFLBK-UHFFFAOYSA-N 27920 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-4-fluoronaphthalene-1-carboxamide::Azabicyclooctane scaffold, 14c Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 38 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27920 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27920&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218664 57560432 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 50993 [H][C@]12CC[C@H](NC(=O)c3ccc(C)c4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C29H40N4O3/c1-17-11-13-22(21-10-8-7-9-20(17)21)27(35)31-23-14-12-19-15-16-33(24(19)23)28(36)25(29(3,4)5)32-26(34)18(2)30-6/h7-11,13,18-19,23-25,30H,12,14-16H2,1-6H3,(H,31,35)(H,32,34) ZDFJYYRBUSKIOX-UHFFFAOYSA-N 27921 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-4-methylnaphthalene-1-carboxamide::Azabicyclooctane scaffold, 14d Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 63 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27921 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27921&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218665 57560433 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 50994 [H][C@]12CC[C@H](NC(=O)c3c(OC)ccc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C29H40N4O4/c1-17(30-5)26(34)32-25(29(2,3)4)28(36)33-16-15-19-11-13-21(24(19)33)31-27(35)23-20-10-8-7-9-18(20)12-14-22(23)37-6/h7-10,12,14,17,19,21,24-25,30H,11,13,15-16H2,1-6H3,(H,31,35)(H,32,34) KULASWCGDWKFRQ-UHFFFAOYSA-N 27922 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2-methoxynaphthalene-1-carboxamide::Azabicyclooctane scaffold, 14e Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 110 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27922 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27922&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218666 57560434 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 50995 [H][C@]12CC[C@H](NC(=O)c3ccc4ccccc4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C28H38N4O3/c1-17(29-5)25(33)31-24(28(2,3)4)27(35)32-15-14-19-12-13-22(23(19)32)30-26(34)21-11-10-18-8-6-7-9-20(18)16-21/h6-11,16-17,19,22-24,29H,12-15H2,1-5H3,(H,30,34)(H,31,33) JFFMYRPQVOGSQN-UHFFFAOYSA-N 27923 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]naphthalene-2-carboxamide::Azabicyclooctane scaffold, 14f Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 91 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27923 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27923&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218667 57560435 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 50996 [H][C@]12CC[C@H](NC(=O)c3ccccc3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C24H36N4O3/c1-15(25-5)21(29)27-20(24(2,3)4)23(31)28-14-13-16-11-12-18(19(16)28)26-22(30)17-9-7-6-8-10-17/h6-10,15-16,18-20,25H,11-14H2,1-5H3,(H,26,30)(H,27,29) IWYPEHHCCCPVAX-UHFFFAOYSA-N 27924 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]benzamide::Azabicyclooctane scaffold, 14g Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 1000 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27924 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27924&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218668 57560436 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 50997 [H][C@]12CC[C@H](NC(=O)c3cccc(c3)S(C)(=O)=O)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C25H38N4O5S/c1-15(26-5)22(30)28-21(25(2,3)4)24(32)29-13-12-16-10-11-19(20(16)29)27-23(31)17-8-7-9-18(14-17)35(6,33)34/h7-9,14-16,19-21,26H,10-13H2,1-6H3,(H,27,31)(H,28,30) ALJBEHLNJJTYSS-UHFFFAOYSA-N 27925 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-3-methanesulfonylbenzamide::Azabicyclooctane scaffold, 14h Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 10000 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27925 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27925&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218669 57560437 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 50998 [H][C@]12CC[C@H](NC(=O)c3cccc4cccnc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C27H37N5O3/c1-16(28-5)24(33)31-23(27(2,3)4)26(35)32-15-13-18-11-12-20(22(18)32)30-25(34)19-10-6-8-17-9-7-14-29-21(17)19/h6-10,14,16,18,20,22-23,28H,11-13,15H2,1-5H3,(H,30,34)(H,31,33) DBSBFQYSCGHURJ-UHFFFAOYSA-N 27926 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]quinoline-8-carboxamide::Azabicyclooctane scaffold, 14i Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 1700 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27926 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27926&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218670 57560438 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 50999 [H][C@]12CC[C@H](NC(=O)c3ccc4occc4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H36N4O4/c1-15(27-5)23(31)29-22(26(2,3)4)25(33)30-12-10-16-6-8-19(21(16)30)28-24(32)18-7-9-20-17(14-18)11-13-34-20/h7,9,11,13-16,19,21-22,27H,6,8,10,12H2,1-5H3,(H,28,32)(H,29,31) SHIOBTFUNOXOLX-UHFFFAOYSA-N 27927 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1-benzofuran-5-carboxamide::Azabicyclooctane scaffold, 14j Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 100 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27927 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27927&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218671 57560439 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51000 [H][C@]12CC[C@H](NC(=O)c3ccc4OCCc4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H38N4O4/c1-15(27-5)23(31)29-22(26(2,3)4)25(33)30-12-10-16-6-8-19(21(16)30)28-24(32)18-7-9-20-17(14-18)11-13-34-20/h7,9,14-16,19,21-22,27H,6,8,10-13H2,1-5H3,(H,28,32)(H,29,31) OCEFHCBADSSFNI-UHFFFAOYSA-N 27928 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2,3-dihydro-1-benzofuran-5-carboxamide::Azabicyclooctane scaffold, 14k Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 780 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27928 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27928&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218672 57560440 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51001 [H][C@]12CC[C@H](NC(=O)c3ccc4OCOc4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C25H36N4O5/c1-14(26-5)22(30)28-21(25(2,3)4)24(32)29-11-10-15-6-8-17(20(15)29)27-23(31)16-7-9-18-19(12-16)34-13-33-18/h7,9,12,14-15,17,20-21,26H,6,8,10-11,13H2,1-5H3,(H,27,31)(H,28,30) DSQABRZXPNMKFS-UHFFFAOYSA-N 27929 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2H-1,3-benzodioxole-5-carboxamide::Azabicyclooctane scaffold, 14l Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 1300 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27929 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27929&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218673 57560441 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51002 [H][C@]12CC[C@H](NC(=O)c3ccc4nc[nH]c4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C25H36N6O3/c1-14(26-5)22(32)30-21(25(2,3)4)24(34)31-11-10-15-6-9-18(20(15)31)29-23(33)16-7-8-17-19(12-16)28-13-27-17/h7-8,12-15,18,20-21,26H,6,9-11H2,1-5H3,(H,27,28)(H,29,33)(H,30,32) HBIHHTINCMTJSZ-UHFFFAOYSA-N 27930 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1H-1,3-benzodiazole-5-carboxamide::Azabicyclooctane scaffold, 14m Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 1700 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27930 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27930&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218674 57560442 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51003 [H][C@]12CC[C@H](NC(=O)c3ccc4nn[nH]c4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C24H35N7O3/c1-13(25-5)21(32)27-20(24(2,3)4)23(34)31-11-10-14-6-9-17(19(14)31)26-22(33)15-7-8-16-18(12-15)29-30-28-16/h7-8,12-14,17,19-20,25H,6,9-11H2,1-5H3,(H,26,33)(H,27,32)(H,28,29,30) LOZPZKNLDREQDD-UHFFFAOYSA-N 27931 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1H-1,2,3-benzotriazole-5-carboxamide::Azabicyclooctane scaffold, 14n Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 260 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27931 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27931&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218675 57560443 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51004 [H][C@]12CC[C@H](NC(=O)c3ccc4nonc4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C24H34N6O4/c1-13(25-5)21(31)27-20(24(2,3)4)23(33)30-11-10-14-6-9-17(19(14)30)26-22(32)15-7-8-16-18(12-15)29-34-28-16/h7-8,12-14,17,19-20,25H,6,9-11H2,1-5H3,(H,26,32)(H,27,31) BNNPYNORGFBPSQ-UHFFFAOYSA-N 27932 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2,1,3-benzoxadiazole-5-carboxamide::Azabicyclooctane scaffold, 14o Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 1800 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27932 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27932&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218676 57560444 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51005 [H][C@]12CC[C@H](NC(=O)C3COc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H38N4O4/c1-15(27-5)23(31)29-22(26(2,3)4)25(33)30-13-12-16-10-11-19(21(16)30)28-24(32)18-14-34-20-9-7-6-8-17(18)20/h6-9,15-16,18-19,21-22,27H,10-14H2,1-5H3,(H,28,32)(H,29,31) PIFSVAAAEYDWOT-UHFFFAOYSA-N 27933 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2,3-dihydro-1-benzofuran-3-carboxamide::Azabicyclooctane scaffold, 14p Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 1500 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27933 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27933&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 11178892 57560445 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51006 [H][C@]12CC[C@H](NC(=O)c3coc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H36N4O4/c1-15(27-5)23(31)29-22(26(2,3)4)25(33)30-13-12-16-10-11-19(21(16)30)28-24(32)18-14-34-20-9-7-6-8-17(18)20/h6-9,14-16,19,21-22,27H,10-13H2,1-5H3,(H,28,32)(H,29,31) LFKRHTZPPCDUBN-UHFFFAOYSA-N 27934 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1-benzofuran-3-carboxamide::Azabicyclooctane scaffold, 14q Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 440 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27934 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27934&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218677 57560446 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51007 [H][C@]12CC[C@H](NC(=O)c3csc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H36N4O3S/c1-15(27-5)23(31)29-22(26(2,3)4)25(33)30-13-12-16-10-11-19(21(16)30)28-24(32)18-14-34-20-9-7-6-8-17(18)20/h6-9,14-16,19,21-22,27H,10-13H2,1-5H3,(H,28,32)(H,29,31) VSALGTVNPILLCS-UHFFFAOYSA-N 27935 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1-benzothiophene-3-carboxamide::Azabicyclooctane scaffold, 14r Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 110 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27935 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27935&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 11705765 57560447 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51008 [H][C@]12CC[C@H](NC(=O)N(C)c3ccccc3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C25H39N5O3/c1-16(26-5)22(31)28-21(25(2,3)4)23(32)30-15-14-17-12-13-19(20(17)30)27-24(33)29(6)18-10-8-7-9-11-18/h7-11,16-17,19-21,26H,12-15H2,1-6H3,(H,27,33)(H,28,31) DBXXUGWDADCOGA-UHFFFAOYSA-N 27936 (2S)-N-[(2S)-1-[(3aR,6S,6aS)-6-{[methyl(phenyl)carbamoyl]amino}-octahydrocyclopenta[b]pyrrol-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::Azabicyclooctane scaffold, 14s Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 1100 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27936 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27936&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218678 57560448 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51009 [H][C@]12CC[C@H](NC(=O)N(C)c3ccc(F)cc3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C25H38FN5O3/c1-15(27-5)22(32)29-21(25(2,3)4)23(33)31-14-13-16-7-12-19(20(16)31)28-24(34)30(6)18-10-8-17(26)9-11-18/h8-11,15-16,19-21,27H,7,12-14H2,1-6H3,(H,28,34)(H,29,32) PCAICZHRVPCSTE-UHFFFAOYSA-N 27937 (2S)-N-[(2S)-1-[(3aR,6S,6aS)-6-{[(4-fluorophenyl)(methyl)carbamoyl]amino}-octahydrocyclopenta[b]pyrrol-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::Azabicyclooctane scaffold, 14t Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 740 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27937 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27937&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218679 57560449 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51010 [H][C@]12CC[C@H](NC(=O)N(C)c3ccccn3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C24H38N6O3/c1-15(25-5)21(31)28-20(24(2,3)4)22(32)30-14-12-16-10-11-17(19(16)30)27-23(33)29(6)18-9-7-8-13-26-18/h7-9,13,15-17,19-20,25H,10-12,14H2,1-6H3,(H,27,33)(H,28,31) BVJVFSVEQPIZHI-UHFFFAOYSA-N 27938 (2S)-N-[(2S)-1-[(3aR,6S,6aS)-6-{[methyl(pyridin-2-yl)carbamoyl]amino}-octahydrocyclopenta[b]pyrrol-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::Azabicyclooctane scaffold, 14u Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 5200 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27938 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27938&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218680 57560450 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51011 [H][C@]12CC[C@H](NC(=O)N3CCc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H39N5O3/c1-16(27-5)23(32)29-22(26(2,3)4)24(33)31-15-13-18-10-11-19(21(18)31)28-25(34)30-14-12-17-8-6-7-9-20(17)30/h6-9,16,18-19,21-22,27H,10-15H2,1-5H3,(H,28,34)(H,29,32) FJAKNADBBZKKLG-UHFFFAOYSA-N 27939 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2,3-dihydro-1H-indole-1-carboxamide::Azabicyclooctane scaffold, 14v Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 1900 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27939 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27939&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218681 57560451 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51012 CN[C@@H](C)C(=O)N[C@H](C(=O)N1CCC[C@H]1CNC(=O)C(c1ccccc1)c1ccccc1)C(C)(C)C |r| InChI=1S/C29H40N4O3/c1-20(30-5)26(34)32-25(29(2,3)4)28(36)33-18-12-17-23(33)19-31-27(35)24(21-13-8-6-9-14-21)22-15-10-7-11-16-22/h6-11,13-16,20,23-25,30H,12,17-19H2,1-5H3,(H,31,35)(H,32,34) PUCIIZPAQVRBTQ-UHFFFAOYSA-N 27940 (2S)-N-[(2S)-1-[(2S)-2-[(1,1-diphenylacetamido)methyl]pyrrolidin-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::butoxycarbonylpyrrolidine derivative, 15a Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 290 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27940 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27940&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218682 57560452 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51013 CN[C@@H](C)C(=O)N[C@H](C(=O)N1CCC[C@H]1CNC(=O)c1cccc2ccccc12)C(C)(C)C |r| InChI=1S/C26H36N4O3/c1-17(27-5)23(31)29-22(26(2,3)4)25(33)30-15-9-12-19(30)16-28-24(32)21-14-8-11-18-10-6-7-13-20(18)21/h6-8,10-11,13-14,17,19,22,27H,9,12,15-16H2,1-5H3,(H,28,32)(H,29,31) FPXSXLPIQWNRHT-UHFFFAOYSA-N 27941 N-{[(2S)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]pyrrolidin-2-yl]methyl}naphthalene-1-carboxamide::butoxycarbonylpyrrolidine derivative, 15b Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 780 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27941 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27941&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 25218683 57560453 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51014 C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(c2ccccc2)c3ccccc3)N InChI=1S/C27H36N4O3/c1-18(2)24(30-25(32)19(3)28)27(34)31-16-10-15-23(31)26(33)29-17-22(20-11-6-4-7-12-20)21-13-8-5-9-14-21/h4-9,11-14,18-19,22-24H,10,15-17,28H2,1-3H3,(H,29,33)(H,30,32) ZJCCVSICICQPSQ-UHFFFAOYSA-N 27942 (2S)-1-[(2S)-2-[(2S)-2-aminopropanamido]-3-methylbutanoyl]-N-(2,2-diphenylethyl)pyrrolidine-2-carboxamide::Ala-Val-Pro-2,2-diphenethylamine, 1 Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] Homo sapiens 43 7.2000 22.00 C Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27942 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3381&target=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27942&enzyme=Complex+of+Baculoviral+IAP+repeat-containing+protein+7+%5B63-159%2CS150G%5D+and+E3+ubiquitin-protein+ligase+XIAP+%5B336-348%5D&column=ki&startPg=0&Increment=50&submit=Search 389 3F7G 25195344 57560454 C03803 1 MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL 3GTA,3GT9,3F7I,3F7H,2I3I,2I3H,3UW5,1OY7,1OXQ,1OXN Baculoviral IAP repeat-containing protein 7 E3 ubiquitin-protein ligase XIAP BIRC7_HUMAN XIAP_HUMAN Q96CA5 P98170 Q9BQV0 Q9H2A8 Q9HAP7 D3DTF2 Q9NQ14 51015 CN[C@@H](C)C(=O)N[C@H](C(=O)N1CC[C@H]2CC[C@H](NC(=O)C(c3ccccc3)c3ccccc3)[C@@H]12)C(C)(C)C InChI=1S/C31H42N4O3/c1-20(32-5)28(36)34-27(31(2,3)4)30(38)35-19-18-23-16-17-24(26(23)35)33-29(37)25(21-12-8-6-9-13-21)22-14-10-7-11-15-22/h6-15,20,23-27,32H,16-19H2,1-5H3,(H,33,37)(H,34,36) BGWQMUKSEXDJIL-UHFFFAOYSA-N 27918 (2S)-N-[(2S)-1-[(3aR,6S,6aS)-6-(2,2-diphenylacetamido)-octahydrocyclopenta[b]pyrrol-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::Azabicyclooctane scaffold, 14a E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 570 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27918 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27918&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25195345 57560430 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51016 C[C@@H](C(=O)N[C@H](C(=O)N1CC[C@@H]2[C@H]1[C@H](CC2)NC(=O)c3cccc4c3cccc4)C(C)(C)C)NC InChI=1S/C28H38N4O3/c1-17(29-5)25(33)31-24(28(2,3)4)27(35)32-16-15-19-13-14-22(23(19)32)30-26(34)21-12-8-10-18-9-6-7-11-20(18)21/h6-12,17,19,22-24,29H,13-16H2,1-5H3,(H,30,34)(H,31,33) FTXKVJPIFDKIID-UHFFFAOYSA-N 27919 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]naphthalene-1-carboxamide::Azabicyclooctane scaffold, 14b E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 140 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27919 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27919&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search G13 3F7I 25195346 57560431 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51017 [H][C@]12CC[C@H](NC(=O)c3ccc(F)c4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C28H37FN4O3/c1-16(30-5)25(34)32-24(28(2,3)4)27(36)33-15-14-17-10-13-22(23(17)33)31-26(35)20-11-12-21(29)19-9-7-6-8-18(19)20/h6-9,11-12,16-17,22-24,30H,10,13-15H2,1-5H3,(H,31,35)(H,32,34) YAJNIUXPYCFLBK-UHFFFAOYSA-N 27920 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-4-fluoronaphthalene-1-carboxamide::Azabicyclooctane scaffold, 14c E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 210 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27920 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27920&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218664 57560432 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51018 [H][C@]12CC[C@H](NC(=O)c3ccc(C)c4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C29H40N4O3/c1-17-11-13-22(21-10-8-7-9-20(17)21)27(35)31-23-14-12-19-15-16-33(24(19)23)28(36)25(29(3,4)5)32-26(34)18(2)30-6/h7-11,13,18-19,23-25,30H,12,14-16H2,1-6H3,(H,31,35)(H,32,34) ZDFJYYRBUSKIOX-UHFFFAOYSA-N 27921 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-4-methylnaphthalene-1-carboxamide::Azabicyclooctane scaffold, 14d E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 190 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27921 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27921&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218665 57560433 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51019 [H][C@]12CC[C@H](NC(=O)c3c(OC)ccc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C29H40N4O4/c1-17(30-5)26(34)32-25(29(2,3)4)28(36)33-16-15-19-11-13-21(24(19)33)31-27(35)23-20-10-8-7-9-18(20)12-14-22(23)37-6/h7-10,12,14,17,19,21,24-25,30H,11,13,15-16H2,1-6H3,(H,31,35)(H,32,34) KULASWCGDWKFRQ-UHFFFAOYSA-N 27922 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2-methoxynaphthalene-1-carboxamide::Azabicyclooctane scaffold, 14e E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 110 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27922 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27922&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218666 57560434 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51020 [H][C@]12CC[C@H](NC(=O)c3ccc4ccccc4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C28H38N4O3/c1-17(29-5)25(33)31-24(28(2,3)4)27(35)32-15-14-19-12-13-22(23(19)32)30-26(34)21-11-10-18-8-6-7-9-20(18)16-21/h6-11,16-17,19,22-24,29H,12-15H2,1-5H3,(H,30,34)(H,31,33) JFFMYRPQVOGSQN-UHFFFAOYSA-N 27923 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]naphthalene-2-carboxamide::Azabicyclooctane scaffold, 14f E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 1200 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27923 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27923&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218667 57560435 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51021 [H][C@]12CC[C@H](NC(=O)c3ccccc3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C24H36N4O3/c1-15(25-5)21(29)27-20(24(2,3)4)23(31)28-14-13-16-11-12-18(19(16)28)26-22(30)17-9-7-6-8-10-17/h6-10,15-16,18-20,25H,11-14H2,1-5H3,(H,26,30)(H,27,29) IWYPEHHCCCPVAX-UHFFFAOYSA-N 27924 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]benzamide::Azabicyclooctane scaffold, 14g E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 500 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27924 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27924&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218668 57560436 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51022 [H][C@]12CC[C@H](NC(=O)c3cccc(c3)S(C)(=O)=O)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C25H38N4O5S/c1-15(26-5)22(30)28-21(25(2,3)4)24(32)29-13-12-16-10-11-19(20(16)29)27-23(31)17-8-7-9-18(14-17)35(6,33)34/h7-9,14-16,19-21,26H,10-13H2,1-6H3,(H,27,31)(H,28,30) ALJBEHLNJJTYSS-UHFFFAOYSA-N 27925 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-3-methanesulfonylbenzamide::Azabicyclooctane scaffold, 14h E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 8100 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27925 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27925&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218669 57560437 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51023 [H][C@]12CC[C@H](NC(=O)c3cccc4cccnc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C27H37N5O3/c1-16(28-5)24(33)31-23(27(2,3)4)26(35)32-15-13-18-11-12-20(22(18)32)30-25(34)19-10-6-8-17-9-7-14-29-21(17)19/h6-10,14,16,18,20,22-23,28H,11-13,15H2,1-5H3,(H,30,34)(H,31,33) DBSBFQYSCGHURJ-UHFFFAOYSA-N 27926 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]quinoline-8-carboxamide::Azabicyclooctane scaffold, 14i E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 1800 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27926 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27926&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218670 57560438 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51024 [H][C@]12CC[C@H](NC(=O)c3ccc4occc4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H36N4O4/c1-15(27-5)23(31)29-22(26(2,3)4)25(33)30-12-10-16-6-8-19(21(16)30)28-24(32)18-7-9-20-17(14-18)11-13-34-20/h7,9,11,13-16,19,21-22,27H,6,8,10,12H2,1-5H3,(H,28,32)(H,29,31) SHIOBTFUNOXOLX-UHFFFAOYSA-N 27927 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1-benzofuran-5-carboxamide::Azabicyclooctane scaffold, 14j E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 490 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27927 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27927&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218671 57560439 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51025 [H][C@]12CC[C@H](NC(=O)c3ccc4OCCc4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H38N4O4/c1-15(27-5)23(31)29-22(26(2,3)4)25(33)30-12-10-16-6-8-19(21(16)30)28-24(32)18-7-9-20-17(14-18)11-13-34-20/h7,9,14-16,19,21-22,27H,6,8,10-13H2,1-5H3,(H,28,32)(H,29,31) OCEFHCBADSSFNI-UHFFFAOYSA-N 27928 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2,3-dihydro-1-benzofuran-5-carboxamide::Azabicyclooctane scaffold, 14k E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 1200 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27928 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27928&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218672 57560440 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51026 [H][C@]12CC[C@H](NC(=O)c3ccc4OCOc4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C25H36N4O5/c1-14(26-5)22(30)28-21(25(2,3)4)24(32)29-11-10-15-6-8-17(20(15)29)27-23(31)16-7-9-18-19(12-16)34-13-33-18/h7,9,12,14-15,17,20-21,26H,6,8,10-11,13H2,1-5H3,(H,27,31)(H,28,30) DSQABRZXPNMKFS-UHFFFAOYSA-N 27929 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2H-1,3-benzodioxole-5-carboxamide::Azabicyclooctane scaffold, 14l E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 1800 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27929 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27929&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218673 57560441 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51027 [H][C@]12CC[C@H](NC(=O)c3ccc4nc[nH]c4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C25H36N6O3/c1-14(26-5)22(32)30-21(25(2,3)4)24(34)31-11-10-15-6-9-18(20(15)31)29-23(33)16-7-8-17-19(12-16)28-13-27-17/h7-8,12-15,18,20-21,26H,6,9-11H2,1-5H3,(H,27,28)(H,29,33)(H,30,32) HBIHHTINCMTJSZ-UHFFFAOYSA-N 27930 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1H-1,3-benzodiazole-5-carboxamide::Azabicyclooctane scaffold, 14m E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 14300 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27930 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27930&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218674 57560442 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51028 [H][C@]12CC[C@H](NC(=O)c3ccc4nn[nH]c4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C24H35N7O3/c1-13(25-5)21(32)27-20(24(2,3)4)23(34)31-11-10-14-6-9-17(19(14)31)26-22(33)15-7-8-16-18(12-15)29-30-28-16/h7-8,12-14,17,19-20,25H,6,9-11H2,1-5H3,(H,26,33)(H,27,32)(H,28,29,30) LOZPZKNLDREQDD-UHFFFAOYSA-N 27931 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1H-1,2,3-benzotriazole-5-carboxamide::Azabicyclooctane scaffold, 14n E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 1500 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27931 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27931&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218675 57560443 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51029 [H][C@]12CC[C@H](NC(=O)c3ccc4nonc4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C24H34N6O4/c1-13(25-5)21(31)27-20(24(2,3)4)23(33)30-11-10-14-6-9-17(19(14)30)26-22(32)15-7-8-16-18(12-15)29-34-28-16/h7-8,12-14,17,19-20,25H,6,9-11H2,1-5H3,(H,26,32)(H,27,31) BNNPYNORGFBPSQ-UHFFFAOYSA-N 27932 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2,1,3-benzoxadiazole-5-carboxamide::Azabicyclooctane scaffold, 14o E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 8600 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27932 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27932&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218676 57560444 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51030 [H][C@]12CC[C@H](NC(=O)C3COc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H38N4O4/c1-15(27-5)23(31)29-22(26(2,3)4)25(33)30-13-12-16-10-11-19(21(16)30)28-24(32)18-14-34-20-9-7-6-8-17(18)20/h6-9,15-16,18-19,21-22,27H,10-14H2,1-5H3,(H,28,32)(H,29,31) PIFSVAAAEYDWOT-UHFFFAOYSA-N 27933 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2,3-dihydro-1-benzofuran-3-carboxamide::Azabicyclooctane scaffold, 14p E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 1300 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27933 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27933&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 11178892 57560445 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51031 [H][C@]12CC[C@H](NC(=O)c3coc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H36N4O4/c1-15(27-5)23(31)29-22(26(2,3)4)25(33)30-13-12-16-10-11-19(21(16)30)28-24(32)18-14-34-20-9-7-6-8-17(18)20/h6-9,14-16,19,21-22,27H,10-13H2,1-5H3,(H,28,32)(H,29,31) LFKRHTZPPCDUBN-UHFFFAOYSA-N 27934 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1-benzofuran-3-carboxamide::Azabicyclooctane scaffold, 14q E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 640 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27934 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27934&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218677 57560446 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51032 [H][C@]12CC[C@H](NC(=O)c3csc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H36N4O3S/c1-15(27-5)23(31)29-22(26(2,3)4)25(33)30-13-12-16-10-11-19(21(16)30)28-24(32)18-14-34-20-9-7-6-8-17(18)20/h6-9,14-16,19,21-22,27H,10-13H2,1-5H3,(H,28,32)(H,29,31) VSALGTVNPILLCS-UHFFFAOYSA-N 27935 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1-benzothiophene-3-carboxamide::Azabicyclooctane scaffold, 14r E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 160 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27935 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27935&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 11705765 57560447 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51033 [H][C@]12CC[C@H](NC(=O)N(C)c3ccccc3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C25H39N5O3/c1-16(26-5)22(31)28-21(25(2,3)4)23(32)30-15-14-17-12-13-19(20(17)30)27-24(33)29(6)18-10-8-7-9-11-18/h7-11,16-17,19-21,26H,12-15H2,1-6H3,(H,27,33)(H,28,31) DBXXUGWDADCOGA-UHFFFAOYSA-N 27936 (2S)-N-[(2S)-1-[(3aR,6S,6aS)-6-{[methyl(phenyl)carbamoyl]amino}-octahydrocyclopenta[b]pyrrol-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::Azabicyclooctane scaffold, 14s E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 330 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27936 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27936&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218678 57560448 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51034 [H][C@]12CC[C@H](NC(=O)N(C)c3ccc(F)cc3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C25H38FN5O3/c1-15(27-5)22(32)29-21(25(2,3)4)23(33)31-14-13-16-7-12-19(20(16)31)28-24(34)30(6)18-10-8-17(26)9-11-18/h8-11,15-16,19-21,27H,7,12-14H2,1-6H3,(H,28,34)(H,29,32) PCAICZHRVPCSTE-UHFFFAOYSA-N 27937 (2S)-N-[(2S)-1-[(3aR,6S,6aS)-6-{[(4-fluorophenyl)(methyl)carbamoyl]amino}-octahydrocyclopenta[b]pyrrol-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::Azabicyclooctane scaffold, 14t E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 580 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27937 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27937&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218679 57560449 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51035 [H][C@]12CC[C@H](NC(=O)N(C)c3ccccn3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C24H38N6O3/c1-15(25-5)21(31)28-20(24(2,3)4)22(32)30-14-12-16-10-11-17(19(16)30)27-23(33)29(6)18-9-7-8-13-26-18/h7-9,13,15-17,19-20,25H,10-12,14H2,1-6H3,(H,27,33)(H,28,31) BVJVFSVEQPIZHI-UHFFFAOYSA-N 27938 (2S)-N-[(2S)-1-[(3aR,6S,6aS)-6-{[methyl(pyridin-2-yl)carbamoyl]amino}-octahydrocyclopenta[b]pyrrol-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::Azabicyclooctane scaffold, 14u E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 5900 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27938 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27938&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218680 57560450 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51036 [H][C@]12CC[C@H](NC(=O)N3CCc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| InChI=1S/C26H39N5O3/c1-16(27-5)23(32)29-22(26(2,3)4)24(33)31-15-13-18-10-11-19(21(18)31)28-25(34)30-14-12-17-8-6-7-9-20(17)30/h6-9,16,18-19,21-22,27H,10-15H2,1-5H3,(H,28,34)(H,29,32) FJAKNADBBZKKLG-UHFFFAOYSA-N 27939 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2,3-dihydro-1H-indole-1-carboxamide::Azabicyclooctane scaffold, 14v E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 1500 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27939 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27939&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218681 57560451 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51037 CN[C@@H](C)C(=O)N[C@H](C(=O)N1CCC[C@H]1CNC(=O)C(c1ccccc1)c1ccccc1)C(C)(C)C |r| InChI=1S/C29H40N4O3/c1-20(30-5)26(34)32-25(29(2,3)4)28(36)33-18-12-17-23(33)19-31-27(35)24(21-13-8-6-9-14-21)22-15-10-7-11-16-22/h6-11,13-16,20,23-25,30H,12,17-19H2,1-5H3,(H,31,35)(H,32,34) PUCIIZPAQVRBTQ-UHFFFAOYSA-N 27940 (2S)-N-[(2S)-1-[(2S)-2-[(1,1-diphenylacetamido)methyl]pyrrolidin-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::butoxycarbonylpyrrolidine derivative, 15a E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 3000 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27940 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27940&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218682 57560452 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51038 CN[C@@H](C)C(=O)N[C@H](C(=O)N1CCC[C@H]1CNC(=O)c1cccc2ccccc12)C(C)(C)C |r| InChI=1S/C26H36N4O3/c1-17(27-5)23(31)29-22(26(2,3)4)25(33)30-15-9-12-19(30)16-28-24(32)21-14-8-11-18-10-6-7-13-20(18)21/h6-8,10-11,13-14,17,19,22,27H,9,12,15-16H2,1-5H3,(H,28,32)(H,29,31) FPXSXLPIQWNRHT-UHFFFAOYSA-N 27941 N-{[(2S)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]pyrrolidin-2-yl]methyl}naphthalene-1-carboxamide::butoxycarbonylpyrrolidine derivative, 15b E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 1600 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27941 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27941&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 25218683 57560453 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51039 C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(c2ccccc2)c3ccccc3)N InChI=1S/C27H36N4O3/c1-18(2)24(30-25(32)19(3)28)27(34)31-16-10-15-23(31)26(33)29-17-22(20-11-6-4-7-12-20)21-13-8-5-9-14-21/h4-9,11-14,18-19,22-24H,10,15-17,28H2,1-3H3,(H,29,33)(H,30,32) ZJCCVSICICQPSQ-UHFFFAOYSA-N 27942 (2S)-1-[(2S)-2-[(2S)-2-aminopropanamido]-3-methylbutanoyl]-N-(2,2-diphenylethyl)pyrrolidine-2-carboxamide::Ala-Val-Pro-2,2-diphenethylamine, 1 E3 ubiquitin-protein ligase XIAP [241-356] Homo sapiens 345 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27942 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2972&target=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27942&enzyme=E3+ubiquitin-protein+ligase+XIAP+%5B241-356%5D&column=ki&startPg=0&Increment=50&submit=Search 389 3F7G 25195344 57560454 C03803 1 SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 3CM7,3CM2,3CLX,6EY2,1G73,1TFT,1TFQ,1G3F,1F9X,2JK7,4EC4,3G76,3EYL,4HY0,2OPZ,2OPY,1NW9,2VSL,8GH7,1I4O E3 ubiquitin-protein ligase XIAP XIAP_HUMAN P98170 D3DTF2 Q9NQ14 51040 CN[C@@H](C)C(=O)N[C@H](C(=O)N1CC[C@H]2CC[C@H](NC(=O)C(c3ccccc3)c3ccccc3)[C@@H]12)C(C)(C)C InChI=1S/C31H42N4O3/c1-20(32-5)28(36)34-27(31(2,3)4)30(38)35-19-18-23-16-17-24(26(23)35)33-29(37)25(21-12-8-6-9-13-21)22-14-10-7-11-15-22/h6-15,20,23-27,32H,16-19H2,1-5H3,(H,33,37)(H,34,36) BGWQMUKSEXDJIL-UHFFFAOYSA-N 27918 (2S)-N-[(2S)-1-[(3aR,6S,6aS)-6-(2,2-diphenylacetamido)-octahydrocyclopenta[b]pyrrol-1-yl]-3,3-dimethyl-1-oxobutan-2-yl]-2-(methylamino)propanamide::Azabicyclooctane scaffold, 14a Baculoviral IAP repeat-containing protein 2 [266-354] Homo sapiens 129 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27918 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1803&target=Baculoviral+IAP+repeat-containing+protein+2+%5B266-354%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27918&enzyme=Baculoviral+IAP+repeat-containing+protein+2+%5B266-354%5D&column=ki&startPg=0&Increment=50&submit=Search 25195345 57560430 1 MQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPH 3T6P,6EXW,4EB9,3OZ1,3MUP,4KMN,5M6N,1QBH,4MU7,4MTI,4LGU,4LGE,4HY5,4HY4,8DSO,8DSF,6W8I,6W7O,6W74,3D9U,3D9T,7TRM,7TRL Baculoviral IAP repeat-containing protein 2 BIRC2_HUMAN Q13490 B4E026 Q16516 Q4TTG0 51041 C[C@@H](C(=O)N[C@H](C(=O)N1CC[C@@H]2[C@H]1[C@H](CC2)NC(=O)c3cccc4c3cccc4)C(C)(C)C)NC InChI=1S/C28H38N4O3/c1-17(29-5)25(33)31-24(28(2,3)4)27(35)32-16-15-19-13-14-22(23(19)32)30-26(34)21-12-8-10-18-9-6-7-11-20(18)21/h6-12,17,19,22-24,29H,13-16H2,1-5H3,(H,30,34)(H,31,33) FTXKVJPIFDKIID-UHFFFAOYSA-N 27919 N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]naphthalene-1-carboxamide::Azabicyclooctane scaffold, 14b Baculoviral IAP repeat-containing protein 2 [266-354] Homo sapiens 33 Curated from the literature by BindingDB 10.1021/jm801450c 10.7270/Q2WH2N9H 19228017 aid1798849 Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ 3/26/2009 4/6/2009 Genentech http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=27919 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1803&target=Baculoviral+IAP+repeat-containing+protein+2+%5B266-354%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=27919&enzyme=Baculoviral+IAP+repeat-containing+protein+2+%5B266-354%5D&column=ki&startPg=0&Increment=50&submit=Search G13 3F7I 25195346 57560431 1 MQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPH 3T6P,6EXW,4EB9,3OZ1,3MUP,4KMN,5M6N,1QBH,4MU7,4MTI,4LGU,4LGE,4HY5,4HY4,8DSO,8DSF,6W8I,6W7O,6W74,3D9U,3D9T,7TRM,7TRL Baculoviral IAP repeat-containing protein 2 BIRC2_HUMAN Q13490 B4E026 Q16516 Q4TTG0