BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 47460 CCOC(=O)c1cccc(c1)B(O)O InChI=1S/C9H11BO4/c1-2-14-9(11)7-4-3-5-8(6-7)10(12)13/h3-6,12-13H,2H2,1H3 REHVCPNQQBDOJJ-UHFFFAOYSA-N 26123 ethyl 3-(dihydroxyboranyl)benzoate::Phenylboronic Acid, 2 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 120 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26123 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26123&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 3249312 56464560 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47461 OB(O)c1cccc(c1)C(F)(F)F InChI=1S/C7H6BF3O2/c9-7(10,11)5-2-1-3-6(4-5)8(12)13/h1-4,12-13H WOAORAPRPVIATR-UHFFFAOYSA-N 26124 [3-(trifluoromethyl)phenyl]boranediol::CHEMBL336239::Phenylboronic Acid, 3 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 80 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26124 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26124&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2734388 56464561 CHEMBL336239 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47462 OB(O)c1cccc(c1)C#N InChI=1S/C7H6BNO2/c9-5-6-2-1-3-7(4-6)8(10)11/h1-4,10-11H XDBHWPLGGBLUHH-UHFFFAOYSA-N 26125 3-(dihydroxyboranyl)benzonitrile::Phenylboronic Acid, 4 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 1600 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26125 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26125&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2734325 56464562 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47463 OB(O)c1cccc(c1)-c1ccccc1 InChI=1S/C12H11BO2/c14-13(15)12-8-4-7-11(9-12)10-5-2-1-3-6-10/h1-9,14-15H GOXICVKOZJFRMB-UHFFFAOYSA-N 26126 (3-phenylphenyl)boranediol::Phenylboronic Acid, 5 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 130 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26126 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26126&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2734315 56464563 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47464 COc1cccc(c1)B(O)O InChI=1S/C7H9BO3/c1-11-7-4-2-3-6(5-7)8(9)10/h2-5,9-10H,1H3 NLLGFYPSWCMUIV-UHFFFAOYSA-N 26127 (3-methoxyphenyl)boranediol::Phenylboronic Acid, 6 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 1900 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26127 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26127&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2734370 56464564 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47465 OB(O)c1ccc(F)cc1 InChI=1S/C6H6BFO2/c8-6-3-1-5(2-4-6)7(9)10/h1-4,9-10H LBUNNMJLXWQQBY-UHFFFAOYSA-N 26128 (4-fluorophenyl)boranediol::CHEMBL344890::Phenylboronic Acid, 7 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 1500 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26128 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26128&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 285645 56464565 CHEMBL344890 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47466 OB(O)c1ccc(cc1)C(F)(F)F InChI=1S/C7H6BF3O2/c9-7(10,11)5-1-3-6(4-2-5)8(12)13/h1-4,12-13H ALMFIOZYDASRRC-UHFFFAOYSA-N 26129 CHEMBL143654::[4-(trifluoromethyl)phenyl]boranediol::Phenylboronic Acid, 8 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 36 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26129 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26129&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2734389 56464566 CHEMBL143654 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47467 B(c1ccc(cc1)[N+](=O)[O-])(O)O InChI=1S/C6H6BNO4/c9-7(10)5-1-3-6(4-2-5)8(11)12/h1-4,9-10H NSFJAFZHYOAMHL-UHFFFAOYSA-N 26130 (4-nitrophenyl)boranediol::Phenylboronic Acid, 9 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 210 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26130 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26130&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search UKH 7NP0 2773552 56464567 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47468 OB(O)c1ccc(cc1)C#N InChI=1S/C7H6BNO2/c9-5-6-1-3-7(4-2-6)8(10)11/h1-4,10-11H CEBAHYWORUOILU-UHFFFAOYSA-N 26131 4-(dihydroxyboranyl)benzonitrile::Phenylboronic Acid, 10 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 290 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26131 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26131&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2734326 56464568 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47469 OB(O)c1ccc(cc1)-c1ccccc1 InChI=1S/C12H11BO2/c14-13(15)12-8-6-11(7-9-12)10-4-2-1-3-5-10/h1-9,14-15H XPEIJWZLPWNNOK-UHFFFAOYSA-N 26132 (4-phenylphenyl)boranediol::Phenylboronic acid, 23::Phenylboronic Acid, 11 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 21 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26132 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26132&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 151253 56464569 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47470 COc1ccc(cc1)B(O)O InChI=1S/C7H9BO3/c1-11-7-4-2-6(3-5-7)8(9)10/h2-5,9-10H,1H3 VOAAEKKFGLPLLU-UHFFFAOYSA-N 26133 CHEMBL21427::(4-methoxyphenyl)boranediol::Phenylboronic Acid, 12 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 2000 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26133 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26133&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 201262 56464570 CHEMBL21427 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47471 CCCCCCCCCc1ccc(cc1)B(O)O InChI=1S/C15H25BO2/c1-2-3-4-5-6-7-8-9-14-10-12-15(13-11-14)16(17)18/h10-13,17-18H,2-9H2,1H3 VONVJOGSLHAKOX-UHFFFAOYSA-N 26134 (4-nonylphenyl)boranediol::Phenylboronic Acid, 13 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 9.1 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26134 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26134&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 4589192 56464571 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47472 OB(O)c1ccccc1F InChI=1S/C6H6BFO2/c8-6-4-2-1-3-5(6)7(9)10/h1-4,9-10H QCSLIRFWJPOENV-UHFFFAOYSA-N 26135 (2-fluorophenyl)boranediol::Phenylboronic Acid, 14 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 710 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26135 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26135&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2734354 56464572 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47473 OB(O)c1ccccc1C(F)(F)F InChI=1S/C7H6BF3O2/c9-7(10,11)5-3-1-2-4-6(5)8(12)13/h1-4,12-13H JNSBEPKGFVENFS-UHFFFAOYSA-N 26136 [2-(trifluoromethyl)phenyl]boranediol::Phenylboronic Acid, 15 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 68000 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26136 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26136&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2734387 56464573 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47474 OB(O)c1ccccc1-c1ccccc1 InChI=1S/C12H11BO2/c14-13(15)12-9-5-4-8-11(12)10-6-2-1-3-7-10/h1-9,14-15H HYCYKHYFIWHGEX-UHFFFAOYSA-N 26137 (2-phenylphenyl)boranediol::Phenylboronic acid, 24::Phenylboronic Acid, 16 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 110000 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26137 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26137&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 4589187 56464574 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47475 COc1ccccc1B(O)O InChI=1S/C7H9BO3/c1-11-7-5-3-2-4-6(7)8(9)10/h2-5,9-10H,1H3 ROEQGIFOWRQYHD-UHFFFAOYSA-N 26138 (2-methoxyphenyl)boranediol::Phenylboronic Acid, 17 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 13000 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26138 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26138&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2733958 56464575 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47476 B(c1cc2ccccc2s1)(O)O InChI=1S/C8H7BO2S/c10-9(11)8-5-6-3-1-2-4-7(6)12-8/h1-5,10-11H YNCYPMUJDDXIRH-UHFFFAOYSA-N 26139 Phenylboronic acid, 11::1-benzothiophen-2-ylboranediol::CHEMBL34964::1-benzothiophen-2-ylboronic acid, 18 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 150 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26139 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26139&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search BZB 3FKV,4BD0,4BD1,3IXG,3IXB,1C3B,4C3Q 2359 56464576 CHEMBL34964 DB04360 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47477 OB(O)c1cc2ccccc2o1 InChI=1S/C8H7BO3/c10-9(11)8-5-6-3-1-2-4-7(6)12-8/h1-5,10-11H PKRRNTJIHGOMRC-UHFFFAOYSA-N 26140 Phenylboronic acid, 21::CHEMBL143399::1-benzofuran-2-ylboranediol::1-benzofuran-2-ylboronic acid, 19 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 330 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26140 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26140&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2776266 56464577 CHEMBL143399 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47478 OB(O)c1ccc(F)nc1 InChI=1S/C5H5BFNO2/c7-5-2-1-4(3-8-5)6(9)10/h1-3,9-10H OJBYZWHAPXIJID-UHFFFAOYSA-N 26141 (6-fluoropyridin-3-yl)boranediol::(6-fluoropyridin-3-yl)boronic acid, 20 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 10000 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26141 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26141&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 2783397 56464578 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47479 B(CCc1ccccc1)(O)O InChI=1S/C8H11BO2/c10-9(11)7-6-8-4-2-1-3-5-8/h1-5,10-11H,6-7H2 VPRUMANMDWQMNF-UHFFFAOYSA-N 26142 (2-phenylethyl)boranediol::Alkylboronic Acid, 21 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 1300 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26142 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26142&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search PBA 6CHA 65389 56464579 DB01963 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47480 OB(O)\C=C\c1ccc(cc1)-c1ccccc1 InChI=1S/C14H13BO2/c16-15(17)11-10-12-6-8-14(9-7-12)13-4-2-1-3-5-13/h1-11,16-17H NTRGFVQIGQYKIL-UHFFFAOYSA-N 26143 [(E)-2-(4-phenylphenyl)ethenyl]boranediol::Alkenylboronic Acid, 22 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 14 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26143 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26143&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 6011033 56464580 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 47481 CCOC(=O)c1cccc(c1)B(O)O InChI=1S/C9H11BO4/c1-2-14-9(11)7-4-3-5-8(6-7)10(12)13/h3-6,12-13H,2H2,1H3 REHVCPNQQBDOJJ-UHFFFAOYSA-N 26123 ethyl 3-(dihydroxyboranyl)benzoate::Phenylboronic Acid, 2 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26123 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26123&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 3249312 56464560 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47482 OB(O)c1cccc(c1)C(F)(F)F InChI=1S/C7H6BF3O2/c9-7(10,11)5-2-1-3-6(4-5)8(12)13/h1-4,12-13H WOAORAPRPVIATR-UHFFFAOYSA-N 26124 [3-(trifluoromethyl)phenyl]boranediol::CHEMBL336239::Phenylboronic Acid, 3 Monoglyceride lipase Homo sapiens 38000 Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26124 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26124&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2734388 56464561 CHEMBL336239 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47483 OB(O)c1cccc(c1)C#N InChI=1S/C7H6BNO2/c9-5-6-2-1-3-7(4-6)8(10)11/h1-4,10-11H XDBHWPLGGBLUHH-UHFFFAOYSA-N 26125 3-(dihydroxyboranyl)benzonitrile::Phenylboronic Acid, 4 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26125 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26125&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2734325 56464562 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47484 OB(O)c1cccc(c1)-c1ccccc1 InChI=1S/C12H11BO2/c14-13(15)12-8-4-7-11(9-12)10-5-2-1-3-6-10/h1-9,14-15H GOXICVKOZJFRMB-UHFFFAOYSA-N 26126 (3-phenylphenyl)boranediol::Phenylboronic Acid, 5 Monoglyceride lipase Homo sapiens 71000 Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26126 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26126&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2734315 56464563 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47485 COc1cccc(c1)B(O)O InChI=1S/C7H9BO3/c1-11-7-4-2-3-6(5-7)8(9)10/h2-5,9-10H,1H3 NLLGFYPSWCMUIV-UHFFFAOYSA-N 26127 (3-methoxyphenyl)boranediol::Phenylboronic Acid, 6 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26127 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26127&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2734370 56464564 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47486 OB(O)c1ccc(F)cc1 InChI=1S/C6H6BFO2/c8-6-3-1-5(2-4-6)7(9)10/h1-4,9-10H LBUNNMJLXWQQBY-UHFFFAOYSA-N 26128 (4-fluorophenyl)boranediol::CHEMBL344890::Phenylboronic Acid, 7 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26128 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26128&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 285645 56464565 CHEMBL344890 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47487 OB(O)c1ccc(cc1)C(F)(F)F InChI=1S/C7H6BF3O2/c9-7(10,11)5-1-3-6(4-2-5)8(12)13/h1-4,12-13H ALMFIOZYDASRRC-UHFFFAOYSA-N 26129 CHEMBL143654::[4-(trifluoromethyl)phenyl]boranediol::Phenylboronic Acid, 8 Monoglyceride lipase Homo sapiens 20000 Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26129 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26129&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2734389 56464566 CHEMBL143654 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47488 B(c1ccc(cc1)[N+](=O)[O-])(O)O InChI=1S/C6H6BNO4/c9-7(10)5-1-3-6(4-2-5)8(11)12/h1-4,9-10H NSFJAFZHYOAMHL-UHFFFAOYSA-N 26130 (4-nitrophenyl)boranediol::Phenylboronic Acid, 9 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26130 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26130&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search UKH 7NP0 2773552 56464567 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47489 OB(O)c1ccc(cc1)C#N InChI=1S/C7H6BNO2/c9-5-6-1-3-7(4-2-6)8(10)11/h1-4,10-11H CEBAHYWORUOILU-UHFFFAOYSA-N 26131 4-(dihydroxyboranyl)benzonitrile::Phenylboronic Acid, 10 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26131 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26131&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2734326 56464568 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47490 OB(O)c1ccc(cc1)-c1ccccc1 InChI=1S/C12H11BO2/c14-13(15)12-8-6-11(7-9-12)10-4-2-1-3-5-10/h1-9,14-15H XPEIJWZLPWNNOK-UHFFFAOYSA-N 26132 (4-phenylphenyl)boranediol::Phenylboronic acid, 23::Phenylboronic Acid, 11 Monoglyceride lipase Homo sapiens 19000 Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26132 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26132&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 151253 56464569 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47491 COc1ccc(cc1)B(O)O InChI=1S/C7H9BO3/c1-11-7-4-2-6(3-5-7)8(9)10/h2-5,9-10H,1H3 VOAAEKKFGLPLLU-UHFFFAOYSA-N 26133 CHEMBL21427::(4-methoxyphenyl)boranediol::Phenylboronic Acid, 12 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26133 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26133&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 201262 56464570 CHEMBL21427 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47492 CCCCCCCCCc1ccc(cc1)B(O)O InChI=1S/C15H25BO2/c1-2-3-4-5-6-7-8-9-14-10-12-15(13-11-14)16(17)18/h10-13,17-18H,2-9H2,1H3 VONVJOGSLHAKOX-UHFFFAOYSA-N 26134 (4-nonylphenyl)boranediol::Phenylboronic Acid, 13 Monoglyceride lipase Homo sapiens 7900 Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26134 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26134&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 4589192 56464571 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47493 OB(O)c1ccccc1F InChI=1S/C6H6BFO2/c8-6-4-2-1-3-5(6)7(9)10/h1-4,9-10H QCSLIRFWJPOENV-UHFFFAOYSA-N 26135 (2-fluorophenyl)boranediol::Phenylboronic Acid, 14 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26135 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26135&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2734354 56464572 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47494 OB(O)c1ccccc1C(F)(F)F InChI=1S/C7H6BF3O2/c9-7(10,11)5-3-1-2-4-6(5)8(12)13/h1-4,12-13H JNSBEPKGFVENFS-UHFFFAOYSA-N 26136 [2-(trifluoromethyl)phenyl]boranediol::Phenylboronic Acid, 15 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26136 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26136&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2734387 56464573 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47495 OB(O)c1ccccc1-c1ccccc1 InChI=1S/C12H11BO2/c14-13(15)12-9-5-4-8-11(12)10-6-2-1-3-7-10/h1-9,14-15H HYCYKHYFIWHGEX-UHFFFAOYSA-N 26137 (2-phenylphenyl)boranediol::Phenylboronic acid, 24::Phenylboronic Acid, 16 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26137 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26137&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 4589187 56464574 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47496 COc1ccccc1B(O)O InChI=1S/C7H9BO3/c1-11-7-5-3-2-4-6(7)8(9)10/h2-5,9-10H,1H3 ROEQGIFOWRQYHD-UHFFFAOYSA-N 26138 (2-methoxyphenyl)boranediol::Phenylboronic Acid, 17 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26138 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26138&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2733958 56464575 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47497 B(c1cc2ccccc2s1)(O)O InChI=1S/C8H7BO2S/c10-9(11)8-5-6-3-1-2-4-7(6)12-8/h1-5,10-11H YNCYPMUJDDXIRH-UHFFFAOYSA-N 26139 Phenylboronic acid, 11::1-benzothiophen-2-ylboranediol::CHEMBL34964::1-benzothiophen-2-ylboronic acid, 18 Monoglyceride lipase Homo sapiens 32000 Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26139 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26139&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search BZB 3FKV,4BD0,4BD1,3IXG,3IXB,1C3B,4C3Q 2359 56464576 CHEMBL34964 DB04360 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47498 OB(O)c1cc2ccccc2o1 InChI=1S/C8H7BO3/c10-9(11)8-5-6-3-1-2-4-7(6)12-8/h1-5,10-11H PKRRNTJIHGOMRC-UHFFFAOYSA-N 26140 Phenylboronic acid, 21::CHEMBL143399::1-benzofuran-2-ylboranediol::1-benzofuran-2-ylboronic acid, 19 Monoglyceride lipase Homo sapiens 100000 Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26140 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26140&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2776266 56464577 CHEMBL143399 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47499 OB(O)c1ccc(F)nc1 InChI=1S/C5H5BFNO2/c7-5-2-1-4(3-8-5)6(9)10/h1-3,9-10H OJBYZWHAPXIJID-UHFFFAOYSA-N 26141 (6-fluoropyridin-3-yl)boranediol::(6-fluoropyridin-3-yl)boronic acid, 20 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26141 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26141&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 2783397 56464578 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47500 B(CCc1ccccc1)(O)O InChI=1S/C8H11BO2/c10-9(11)7-6-8-4-2-1-3-5-8/h1-5,10-11H,6-7H2 VPRUMANMDWQMNF-UHFFFAOYSA-N 26142 (2-phenylethyl)boranediol::Alkylboronic Acid, 21 Monoglyceride lipase Homo sapiens Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26142 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26142&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search PBA 6CHA 65389 56464579 DB01963 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 47501 OB(O)\C=C\c1ccc(cc1)-c1ccccc1 InChI=1S/C14H13BO2/c16-15(17)11-10-12-6-8-14(9-7-12)13-4-2-1-3-5-13/h1-11,16-17H NTRGFVQIGQYKIL-UHFFFAOYSA-N 26143 [(E)-2-(4-phenylphenyl)ethenyl]boranediol::Alkenylboronic Acid, 22 Monoglyceride lipase Homo sapiens 31000 Curated from the literature by BindingDB 10.1021/jm801051t 10.7270/Q25D8Q58 18983140 aid1798637 Minkkilä, A; Saario, SM; Käsnänen, H; Leppänen, J; Poso, A; Nevalainen, T 11/5/2008 12/17/2008 University of Oxford http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26143 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26143&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 6011033 56464580 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5