BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51005896 O=C1Cc2c([nH]c3ccc(cc23)C#N)-c2cc(ccc2N1)C#N InChI=1S/C18H10N4O/c19-8-10-1-3-15-12(5-10)13-7-17(23)21-16-4-2-11(9-20)6-14(16)18(13)22-15/h1-6,22H,7H2,(H,21,23) FSCLZTCYWFNGON-UHFFFAOYSA-N 50376078 CHEMBL264177 Cyclin-dependent kinase 5 activator 1 Homo sapiens 730 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376078 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376078&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828863 160855168 CHEMBL264177 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005897 Cn1c-2c(CC(=O)Nc3cccnc-23)c2ccccc12 InChI=1S/C16H13N3O/c1-19-13-7-3-2-5-10(13)11-9-14(20)18-12-6-4-8-17-15(12)16(11)19/h2-8H,9H2,1H3,(H,18,20) XJOVBFOCPFDWAG-UHFFFAOYSA-N 50376086 CHEMBL260656 Cyclin-dependent kinase 5 activator 1 Homo sapiens 3000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376086 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376086&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828436 160855176 CHEMBL260656 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005898 COc1ccc2[nH]c-3c(CC(=O)Nc4ccncc-34)c2c1 InChI=1S/C16H13N3O2/c1-21-9-2-3-13-10(6-9)11-7-15(20)18-14-4-5-17-8-12(14)16(11)19-13/h2-6,8,19H,7H2,1H3,(H,18,20) HNGSMPZLGYDZOV-UHFFFAOYSA-N 50376087 CHEMBL407408 Cyclin-dependent kinase 5 activator 1 Homo sapiens 400 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376087 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376087&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828984 160855177 CHEMBL407408 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005899 Clc1ccc2[nH]c-3c(CC(=O)Nc4ccncc-34)c2c1 InChI=1S/C15H10ClN3O/c16-8-1-2-12-9(5-8)10-6-14(20)18-13-3-4-17-7-11(13)15(10)19-12/h1-5,7,19H,6H2,(H,18,20) ZXOPGTSQJRRYHF-UHFFFAOYSA-N 50376088 CHEMBL260045 Cyclin-dependent kinase 5 activator 1 Homo sapiens 210 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376088 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376088&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828983 160855178 CHEMBL260045 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005900 Fc1ccc2[nH]c-3c(CC(=O)Nc4ccncc-34)c2c1 InChI=1S/C15H10FN3O/c16-8-1-2-12-9(5-8)10-6-14(20)18-13-3-4-17-7-11(13)15(10)19-12/h1-5,7,19H,6H2,(H,18,20) WDPWBLOFHHDUCY-UHFFFAOYSA-N 50376089 CHEMBL260657 Cyclin-dependent kinase 5 activator 1 Homo sapiens 260 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376089 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376089&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828435 160855179 CHEMBL260657 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005901 FC(F)(F)c1ccc2[nH]c-3c(CC(=O)Nc4ccncc-34)c2c1 InChI=1S/C16H10F3N3O/c17-16(18,19)8-1-2-12-9(5-8)10-6-14(23)21-13-3-4-20-7-11(13)15(10)22-12/h1-5,7,22H,6H2,(H,21,23) UJFAOQFICNRWOP-UHFFFAOYSA-N 50376090 CHEMBL260119 Cyclin-dependent kinase 5 activator 1 Homo sapiens 120 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376090 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376090&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828982 160855180 CHEMBL260119 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005902 O=C1Cc2c([nH]c3ccc(cc23)C#N)-c2cnccc2N1 InChI=1S/C16H10N4O/c17-7-9-1-2-13-10(5-9)11-6-15(21)19-14-3-4-18-8-12(14)16(11)20-13/h1-5,8,20H,6H2,(H,19,21) OYPIIVNTYVSCNV-UHFFFAOYSA-N 50376091 CHEMBL260136 Cyclin-dependent kinase 5 activator 1 Homo sapiens 32 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376091 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376091&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828434 160855181 CHEMBL260136 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005903 Brc1ccc2[nH]c-3c(CC(=O)Nc4ccncc-34)c2c1 InChI=1S/C15H10BrN3O/c16-8-1-2-12-9(5-8)10-6-14(20)18-13-3-4-17-7-11(13)15(10)19-12/h1-5,7,19H,6H2,(H,18,20) RQUYLFVCZMFFCI-UHFFFAOYSA-N 50376092 CHEMBL406619 Cyclin-dependent kinase 5 activator 1 Homo sapiens 180 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376092 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376092&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828981 160855182 CHEMBL406619 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005904 Brc1ccc2NC(=O)Cc3c([nH]c4ccc(cc34)C#N)-c2n1 InChI=1S/C16H9BrN4O/c17-13-4-3-12-16(21-13)15-10(6-14(22)19-12)9-5-8(7-18)1-2-11(9)20-15/h1-5,20H,6H2,(H,19,22) HSNASFPPYVOOEC-UHFFFAOYSA-N 50376093 CHEMBL413294 Cyclin-dependent kinase 5 activator 1 Homo sapiens 10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376093 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376093&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828296 160855183 CHEMBL413294 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005905 Ic1cc(cc2c3CC(=O)Nc4cccnc4-c3[nH]c12)C#N InChI=1S/C16H9IN4O/c17-11-5-8(7-18)4-9-10-6-13(22)20-12-2-1-3-19-16(12)15(10)21-14(9)11/h1-5,21H,6H2,(H,20,22) PRYCSPQYECFTEG-UHFFFAOYSA-N 50376094 CHEMBL258482 Cyclin-dependent kinase 5 activator 1 Homo sapiens 2000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376094 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376094&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828870 160855184 CHEMBL258482 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005906 Oc1ccc2[nH]c-3c(CC(=O)Nc4cccnc-34)c2c1 InChI=1S/C15H11N3O2/c19-8-3-4-11-9(6-8)10-7-13(20)17-12-2-1-5-16-15(12)14(10)18-11/h1-6,18-19H,7H2,(H,17,20) SNUBQZDSBMJCOL-UHFFFAOYSA-N 50376095 CHEMBL261252 Cyclin-dependent kinase 5 activator 1 Homo sapiens 5000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376095 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376095&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828174 160855185 CHEMBL261252 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005907 Cc1ccc2[nH]c-3c(CC(=O)Nc4cccnc-34)c2c1 InChI=1S/C16H13N3O/c1-9-4-5-12-10(7-9)11-8-14(20)18-13-3-2-6-17-16(13)15(11)19-12/h2-7,19H,8H2,1H3,(H,18,20) UGQLDHDCARQGQN-UHFFFAOYSA-N 50376096 CHEMBL409492 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376096 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376096&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828869 160855186 CHEMBL409492 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005908 COc1ccc2[nH]c-3c(CC(=O)Nc4cccnc-34)c2c1 InChI=1S/C16H13N3O2/c1-21-9-4-5-12-10(7-9)11-8-14(20)18-13-3-2-6-17-16(13)15(11)19-12/h2-7,19H,8H2,1H3,(H,18,20) OABFHHUXJBWVRL-UHFFFAOYSA-N 50376097 CHEMBL258700 Cyclin-dependent kinase 5 activator 1 Homo sapiens 4000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376097 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376097&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828173 160855187 CHEMBL258700 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005909 Fc1cc(F)c2[nH]c-3c(CC(=O)Nc4cccnc-34)c2c1 InChI=1S/C15H9F2N3O/c16-7-4-8-9-6-12(21)19-11-2-1-3-18-15(11)14(9)20-13(8)10(17)5-7/h1-5,20H,6H2,(H,19,21) DYYPGVLVNFFNRH-UHFFFAOYSA-N 50376098 CHEMBL407413 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376098 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376098&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828868 160855188 CHEMBL407413 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005910 Ic1ccc2[nH]c-3c(CC(=O)Nc4cccnc-34)c2c1 InChI=1S/C15H10IN3O/c16-8-3-4-11-9(6-8)10-7-13(20)18-12-2-1-5-17-15(12)14(10)19-11/h1-6,19H,7H2,(H,18,20) DZQKEZDDWGRQEW-UHFFFAOYSA-N 50376099 CHEMBL260487 Cyclin-dependent kinase 5 activator 1 Homo sapiens 6000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376099 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376099&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828867 160855189 CHEMBL260487 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005911 O=C1Cc2c([nH]c3ccccc23)-c2ncccc2N1 InChI=1S/C15H11N3O/c19-13-8-10-9-4-1-2-5-11(9)18-14(10)15-12(17-13)6-3-7-16-15/h1-7,18H,8H2,(H,17,19) GVRZEQYUWSXMPG-UHFFFAOYSA-N 50376100 CHEMBL260678 Cyclin-dependent kinase 5 activator 1 Homo sapiens 9000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376100 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376100&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828172 160855190 CHEMBL260678 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005912 Clc1cc(Cl)c2c3CC(=O)Nc4cccnc4-c3[nH]c2c1 InChI=1S/C15H9Cl2N3O/c16-7-4-9(17)13-8-6-12(21)19-10-2-1-3-18-15(10)14(8)20-11(13)5-7/h1-5,20H,6H2,(H,19,21) GCULKEKNSKDWPK-UHFFFAOYSA-N 50376101 CHEMBL260679 Cyclin-dependent kinase 5 activator 1 Homo sapiens 100000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376101 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376101&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828866 160855191 CHEMBL260679 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005913 OC(=O)c1ccc2[nH]c-3c(CC(=O)Nc4cccnc-34)c2c1 InChI=1S/C16H11N3O3/c20-13-7-10-9-6-8(16(21)22)3-4-11(9)19-14(10)15-12(18-13)2-1-5-17-15/h1-6,19H,7H2,(H,18,20)(H,21,22) GPMZPDSPXPFGTI-UHFFFAOYSA-N 50376102 CHEMBL261025 Cyclin-dependent kinase 5 activator 1 Homo sapiens 30000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376102 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376102&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828171 160855192 CHEMBL261025 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005914 Clc1ccc2[nH]c-3c(CC(=O)Nc4cccnc-34)c2c1 InChI=1S/C15H10ClN3O/c16-8-3-4-11-9(6-8)10-7-13(20)18-12-2-1-5-17-15(12)14(10)19-11/h1-6,19H,7H2,(H,18,20) RDOMSKHQXREQOV-UHFFFAOYSA-N 50376103 CHEMBL406748 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376103 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376103&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828865 160855193 CHEMBL406748 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005915 Fc1ccc2[nH]c-3c(CC(=O)Nc4cccnc-34)c2c1 InChI=1S/C15H10FN3O/c16-8-3-4-11-9(6-8)10-7-13(20)18-12-2-1-5-17-15(12)14(10)19-11/h1-6,19H,7H2,(H,18,20) ADLJJDVYJGLCRQ-UHFFFAOYSA-N 50376104 CHEMBL261470 Cyclin-dependent kinase 5 activator 1 Homo sapiens 3000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376104 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376104&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828170 160855194 CHEMBL261470 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005916 FC(F)(F)c1ccc2[nH]c-3c(CC(=O)Nc4cccnc-34)c2c1 InChI=1S/C16H10F3N3O/c17-16(18,19)8-3-4-11-9(6-8)10-7-13(23)21-12-2-1-5-20-15(12)14(10)22-11/h1-6,22H,7H2,(H,21,23) CREZMKDQPXPVKO-UHFFFAOYSA-N 50376105 CHEMBL411728 Cyclin-dependent kinase 5 activator 1 Homo sapiens 10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376105 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376105&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828864 160855195 CHEMBL411728 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005917 O=C1Cc2c([nH]c3ccc(cc23)C#N)-c2ncccc2N1 InChI=1S/C16H10N4O/c17-8-9-3-4-12-10(6-9)11-7-14(21)19-13-2-1-5-18-16(13)15(11)20-12/h1-6,20H,7H2,(H,19,21) MGQSIUXWCFOENX-UHFFFAOYSA-N 50376106 CHEMBL259638 Cyclin-dependent kinase 5 activator 1 Homo sapiens 300 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376106 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376106&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 11949637 160855196 CHEMBL259638 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005918 Brc1ccc2[nH]c-3c(CC(=O)Nc4cccnc-34)c2c1 InChI=1S/C15H10BrN3O/c16-8-3-4-11-9(6-8)10-7-13(20)18-12-2-1-5-17-15(12)14(10)19-11/h1-6,19H,7H2,(H,18,20) NTSBZVCEIVPKBJ-UHFFFAOYSA-N 7497 14-bromo-3,8,18-triazatetracyclo[9.7.0.0^{2,7}.0^{12,17}]octadeca-1(11),2,4,6,12(17),13,15-heptaen-9-one::1-Azakenpaullone::US11759530, Compound Table1.11 Cyclin-dependent kinase 5 activator 1 Homo sapiens 4200 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7497 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7497&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 6538897 11108285 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005919 [O-][N+](=O)c1ccc2[nH]c-3c(CC(=O)Nc4ccccc-34)c2c1 InChI=1S/C16H11N3O3/c20-15-8-12-11-7-9(19(21)22)5-6-14(11)18-16(12)10-3-1-2-4-13(10)17-15/h1-7,18H,8H2,(H,17,20) OLUKILHGKRVDCT-UHFFFAOYSA-N 7262 NSC 705701::BDBM84528::alsterpaullone::9-Nitropaullone::14-nitro-8,18-diazatetracyclo[9.7.0.0^{2,7}.0^{12,17}]octadeca-1(11),2,4,6,12(17),13,15-heptaen-9-one::CHEMBL50894::Paullone Analog 1 Cyclin-dependent kinase 5 activator 1 Homo sapiens 40 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7262 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7262&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 5005498 8036818 CHEMBL50894 DB04014 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005920 Clc1ccc2oc-3c(CC(=O)Nc4ccccc-34)c2c1 InChI=1S/C16H10ClNO2/c17-9-5-6-14-11(7-9)12-8-15(19)18-13-4-2-1-3-10(13)16(12)20-14/h1-7H,8H2,(H,18,19) YKLYNLNNKIZVNS-UHFFFAOYSA-N 50376108 CHEMBL264179 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376108 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376108&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828725 160855198 CHEMBL264179 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005921 Brc1ccc2oc-3c(CC(=O)Nc4ccccc-34)c2c1 InChI=1S/C16H10BrNO2/c17-9-5-6-14-11(7-9)12-8-15(19)18-13-4-2-1-3-10(13)16(12)20-14/h1-7H,8H2,(H,18,19) JIOLMXHWCLOSJU-UHFFFAOYSA-N 50376079 CHEMBL441733 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376079 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376079&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828724 160855169 CHEMBL441733 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005922 O=C1Cc2c(oc3ccccc23)-c2ccccc2N1 InChI=1S/C16H11NO2/c18-15-9-12-10-5-2-4-8-14(10)19-16(12)11-6-1-3-7-13(11)17-15/h1-8H,9H2,(H,17,18) MTJNVONGPGXCPJ-UHFFFAOYSA-N 50376080 CHEMBL410936 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376080 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376080&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828570 160855170 CHEMBL410936 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005923 CCn1c-2c(CC(=O)Nc3ccncc-23)c2ccccc12 InChI=1S/C17H15N3O/c1-2-20-15-6-4-3-5-11(15)12-9-16(21)19-14-7-8-18-10-13(14)17(12)20/h3-8,10H,2,9H2,1H3,(H,19,21) ADGQZIUZHRRUQA-UHFFFAOYSA-N 50376109 CHEMBL411133 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376109 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376109&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828988 160855199 CHEMBL411133 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005924 Cn1c-2c(CC(=O)Nc3ccncc-23)c2ccccc12 InChI=1S/C16H13N3O/c1-19-14-5-3-2-4-10(14)11-8-15(20)18-13-6-7-17-9-12(13)16(11)19/h2-7,9H,8H2,1H3,(H,18,20) HCJQIBXTZXVZLX-UHFFFAOYSA-N 50376082 CHEMBL411641 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376082 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376082&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828987 160855172 CHEMBL411641 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005925 O=C1Cc2c(-c3ncccc3N1)n1CCc3cccc2c13 InChI=1S/C17H13N3O/c21-14-9-12-11-4-1-3-10-6-8-20(16(10)11)17(12)15-13(19-14)5-2-7-18-15/h1-5,7H,6,8-9H2,(H,19,21) GGYPDKUMTHBHNO-UHFFFAOYSA-N 50376083 CHEMBL259697 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376083 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376083&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828438 160855173 CHEMBL259697 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005926 O=C1Cc2c(-c3ncccc3N1)n(Cc1ccccc1)c1ccccc21 InChI=1S/C22H17N3O/c26-20-13-17-16-9-4-5-11-19(16)25(14-15-7-2-1-3-8-15)22(17)21-18(24-20)10-6-12-23-21/h1-12H,13-14H2,(H,24,26) WWNHBQZAGKFTGQ-UHFFFAOYSA-N 50376107 CHEMBL429329 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376107 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376107&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828437 160855197 CHEMBL429329 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005927 CCn1c-2c(CC(=O)Nc3cccnc-23)c2ccccc12 InChI=1S/C17H15N3O/c1-2-20-14-8-4-3-6-11(14)12-10-15(21)19-13-7-5-9-18-16(13)17(12)20/h3-9H,2,10H2,1H3,(H,19,21) HAEZWCSEOSXPCB-UHFFFAOYSA-N 50376085 CHEMBL412255 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376085&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828985 160855175 CHEMBL412255 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005928 Brc1ccc2[nH]c-3c(CC(=O)Nc4ccccc-34)c2c1 InChI=1S/C16H11BrN2O/c17-9-5-6-14-11(7-9)12-8-15(20)18-13-4-2-1-3-10(13)16(12)19-14/h1-7,19H,8H2,(H,18,20) QQUXFYAWXPMDOE-UHFFFAOYSA-N 7266 cid_3820::NSC 664704::9-bromopaullone::14-bromo-8,18-diazatetracyclo[9.7.0.0^{2,7}.0^{12,17}]octadeca-1(11),2,4,6,12(17),13,15-heptaen-9-one::CHEMBL296586::Paullone Analog 5::Kenpaullone Cyclin-dependent kinase 5 activator 1 Homo sapiens 850 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7266 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7266&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 3820 8036822 CHEMBL296586 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005929 O=C1Cc2c(-c3cnccc3N1)n(Cc1ccccc1)c1ccccc21 InChI=1S/C22H17N3O/c26-21-12-17-16-8-4-5-9-20(16)25(14-15-6-2-1-3-7-15)22(17)18-13-23-11-10-19(18)24-21/h1-11,13H,12,14H2,(H,24,26) DFOQUEDJAQZZIV-UHFFFAOYSA-N 50376081 CHEMBL260428 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376081 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376081&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828439 160855171 CHEMBL260428 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4 51005930 O=C1Cc2c(-c3ncccc3N1)n(-c1ccccc1)c1ccccc21 InChI=1S/C21H15N3O/c25-19-13-16-15-9-4-5-11-18(15)24(14-7-2-1-3-8-14)21(16)20-17(23-19)10-6-12-22-20/h1-12H,13H2,(H,23,25) XULOFXLOWMKSLI-UHFFFAOYSA-N 50376084 CHEMBL411642 Cyclin-dependent kinase 5 activator 1 Homo sapiens >10000 ChEMBL 10.1021/jm701582f 10.7270/Q2SF2X22 18345612 Stukenbrock, H; Mussmann, R; Geese, M; Ferandin, Y; Lozach, O; Lemcke, T; Kegel, S; Lomow, A; Burk, U; Dohrmann, C; Meijer, L; Austen, M; Kunick, C 4/4/2008 12/15/2012 Technische Universit£T Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50376084 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=108&target=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50376084&enzyme=Cyclin-dependent+kinase+5+activator+1&column=ki&startPg=0&Increment=50&submit=Search 24828986 160855174 CHEMBL411642 2 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 1UNL,1UNH,1UNG,7VDS,7VDR,7VDQ,7VDP,3O0G,1H4L Cyclin-dependent kinase 5 activator 1 CD5R1_HUMAN Q15078 E1P664 Q5U0G3 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP 4AU8,7VDS,7VDR,7VDQ,7VDP Cyclin-dependent kinase 5 CDK5_HUMAN Q00535 A1XKG3 Cyclin-dependent kinase 5 A0A090N7W4_HUMAN A0A090N7W4