BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50862762	CC1CNC(=O)c2[nH]c3ccc(cc3c12)C(=O)Nc1nc(cs1)C(=O)NC1CCCCC1 |w:1.0|	InChI=1S/C23H25N5O3S/c1-12-10-24-22(31)19-18(12)15-9-13(7-8-16(15)26-19)20(29)28-23-27-17(11-32-23)21(30)25-14-5-3-2-4-6-14/h7-9,11-12,14,26H,2-6,10H2,1H3,(H,24,31)(H,25,30)(H,27,28,29)	WIVODQGHXOFCFL-UHFFFAOYSA-N	50374678	CHEMBL246300	MAP kinase-activated protein kinase 2	Homo sapiens		 44							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374678	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374678&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44143538	160853768		CHEMBL246300					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862763	O=C(NC1CCN(Cc2ccccc2)CC1)c1csc(NC(=O)c2ccc3cc4C(=O)NCC5(CCC5)n4c3c2)n1	InChI=1S/C31H32N6O3S/c38-27(22-8-7-21-15-26-29(40)32-19-31(11-4-12-31)37(26)25(21)16-22)35-30-34-24(18-41-30)28(39)33-23-9-13-36(14-10-23)17-20-5-2-1-3-6-20/h1-3,5-8,15-16,18,23H,4,9-14,17,19H2,(H,32,40)(H,33,39)(H,34,35,38)	QXQDLEUEUWFHGW-UHFFFAOYSA-N	50374679	CHEMBL403258	MAP kinase-activated protein kinase 2	Homo sapiens		 3							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374679	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374679&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454601	160853769		CHEMBL403258					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862764	CC1(C)CNC(=O)c2cc3ccc(cc3n12)C(=O)Nc1nc(cs1)C(=O)NC1CCN(Cc2ccccc2)CC1	InChI=1S/C30H32N6O3S/c1-30(2)18-31-28(39)25-14-20-8-9-21(15-24(20)36(25)30)26(37)34-29-33-23(17-40-29)27(38)32-22-10-12-35(13-11-22)16-19-6-4-3-5-7-19/h3-9,14-15,17,22H,10-13,16,18H2,1-2H3,(H,31,39)(H,32,38)(H,33,34,37)	XGMZRFLQBXOCKP-UHFFFAOYSA-N	50374680	CHEMBL429504	MAP kinase-activated protein kinase 2	Homo sapiens		 5							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374680	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374680&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454600	160853770		CHEMBL429504					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862765	CC(C)(C)CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC5(CCC5)n4c3c2)n1	InChI=1S/C29H36N6O3S/c1-28(2,3)17-34-11-7-20(8-12-34)31-25(37)21-15-39-27(32-21)33-24(36)19-6-5-18-13-23-26(38)30-16-29(9-4-10-29)35(23)22(18)14-19/h5-6,13-15,20H,4,7-12,16-17H2,1-3H3,(H,30,38)(H,31,37)(H,32,33,36)	MJQUKUIDCUNAAB-UHFFFAOYSA-N	50374681	CHEMBL257834	MAP kinase-activated protein kinase 2	Homo sapiens		 2							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374681	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374681&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			24882562	160853771		CHEMBL257834					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862766	CC(C)(C)CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC(C)(C)n4c3c2)n1	InChI=1S/C28H36N6O3S/c1-27(2,3)16-33-10-8-19(9-11-33)30-24(36)20-14-38-26(31-20)32-23(35)18-7-6-17-12-22-25(37)29-15-28(4,5)34(22)21(17)13-18/h6-7,12-14,19H,8-11,15-16H2,1-5H3,(H,29,37)(H,30,36)(H,31,32,35)	WWRZEFXYASLXQU-UHFFFAOYSA-N	50374682	CHEMBL403154	MAP kinase-activated protein kinase 2	Homo sapiens		 2							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374682	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374682&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454629	160853772		CHEMBL403154					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862767	CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC5(CCC5)n4c3c2)n1	InChI=1S/C25H28N6O3S/c1-30-9-5-17(6-10-30)27-22(33)18-13-35-24(28-18)29-21(32)16-4-3-15-11-20-23(34)26-14-25(7-2-8-25)31(20)19(15)12-16/h3-4,11-13,17H,2,5-10,14H2,1H3,(H,26,34)(H,27,33)(H,28,29,32)	GGVFNPFXQLBATK-UHFFFAOYSA-N	50374683	CHEMBL258045	MAP kinase-activated protein kinase 2	Homo sapiens		 2							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374683	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374683&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454631	160853773		CHEMBL258045					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862768	CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC(C)(C)n4c3c2)n1	InChI=1S/C24H28N6O3S/c1-24(2)13-25-22(33)19-10-14-4-5-15(11-18(14)30(19)24)20(31)28-23-27-17(12-34-23)21(32)26-16-6-8-29(3)9-7-16/h4-5,10-12,16H,6-9,13H2,1-3H3,(H,25,33)(H,26,32)(H,27,28,31)	XWFUFXHTXQHKMY-UHFFFAOYSA-N	50374684	CHEMBL270148	MAP kinase-activated protein kinase 2	Homo sapiens		 5							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374684	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374684&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454652	160853774		CHEMBL270148					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862769	CC1(C)CNC(=O)c2cc3ccc(cc3n12)C(=O)Nc1nc(cs1)C(=O)NC1CCCCC1	InChI=1S/C24H27N5O3S/c1-24(2)13-25-22(32)19-10-14-8-9-15(11-18(14)29(19)24)20(30)28-23-27-17(12-33-23)21(31)26-16-6-4-3-5-7-16/h8-12,16H,3-7,13H2,1-2H3,(H,25,32)(H,26,31)(H,27,28,30)	NCJUTJMETHXIGT-UHFFFAOYSA-N	50374685	CHEMBL270150	MAP kinase-activated protein kinase 2	Homo sapiens		 19							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374685	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374685&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454654	160853775		CHEMBL270150					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862770	CC1CNC(=O)c2cc3ccc(cc3n12)C(=O)Nc1nc(cs1)C(=O)NC1CCN(Cc2ccccc2)CC1 |w:1.0|	InChI=1S/C29H30N6O3S/c1-18-15-30-28(38)25-13-20-7-8-21(14-24(20)35(18)25)26(36)33-29-32-23(17-39-29)27(37)31-22-9-11-34(12-10-22)16-19-5-3-2-4-6-19/h2-8,13-14,17-18,22H,9-12,15-16H2,1H3,(H,30,38)(H,31,37)(H,32,33,36)	KMABUODWYFGFEI-UHFFFAOYSA-N	50374686	CHEMBL403286	MAP kinase-activated protein kinase 2	Homo sapiens		 9							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374686	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374686&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454653	160853776		CHEMBL403286					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862771	CC1CNC(=O)c2cc3ccc(cc3n12)C(=O)Nc1nc(cs1)C(=O)NC1CCN(CC(C)(C)C)CC1 |w:1.0|	InChI=1S/C27H34N6O3S/c1-16-13-28-25(36)22-11-17-5-6-18(12-21(17)33(16)22)23(34)31-26-30-20(14-37-26)24(35)29-19-7-9-32(10-8-19)15-27(2,3)4/h5-6,11-12,14,16,19H,7-10,13,15H2,1-4H3,(H,28,36)(H,29,35)(H,30,31,34)	GXDHJMHFSCNYBN-UHFFFAOYSA-N	50374687	CHEMBL256194	MAP kinase-activated protein kinase 2	Homo sapiens		 3							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374687	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374687&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454680	160853777		CHEMBL256194					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862772	CC(C)CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC(C)n4c3c2)n1 |w:30.31|	InChI=1S/C26H32N6O3S/c1-15(2)13-31-8-6-19(7-9-31)28-24(34)20-14-36-26(29-20)30-23(33)18-5-4-17-10-22-25(35)27-12-16(3)32(22)21(17)11-18/h4-5,10-11,14-16,19H,6-9,12-13H2,1-3H3,(H,27,35)(H,28,34)(H,29,30,33)	QLMOSLLPTJWRHG-UHFFFAOYSA-N	50374688	CHEMBL255991	MAP kinase-activated protein kinase 2	Homo sapiens		 4							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374688	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374688&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454679	160853778		CHEMBL255991					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862773	CCN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC(C)n4c3c2)n1 |w:28.29|	InChI=1S/C24H28N6O3S/c1-3-29-8-6-17(7-9-29)26-22(32)18-13-34-24(27-18)28-21(31)16-5-4-15-10-20-23(33)25-12-14(2)30(20)19(15)11-16/h4-5,10-11,13-14,17H,3,6-9,12H2,1-2H3,(H,25,33)(H,26,32)(H,27,28,31)	GITCIQPIHDKHIG-UHFFFAOYSA-N	50374689	CHEMBL256196	MAP kinase-activated protein kinase 2	Homo sapiens		 7							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374689	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374689&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454683	160853779		CHEMBL256196					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862774	CC1CNC(=O)c2cc3ccc(cc3n12)C(=O)Nc1nc(cs1)C(=O)NCC(C)(C)C |w:1.0|	InChI=1S/C22H25N5O3S/c1-12-9-23-20(30)17-7-13-5-6-14(8-16(13)27(12)17)18(28)26-21-25-15(10-31-21)19(29)24-11-22(2,3)4/h5-8,10,12H,9,11H2,1-4H3,(H,23,30)(H,24,29)(H,25,26,28)	JGNZTJUQNULPSL-UHFFFAOYSA-N	50374690	CHEMBL271863	MAP kinase-activated protein kinase 2	Homo sapiens		 46							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374690	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374690&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454705	160853780		CHEMBL271863					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862775	CC1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC(C)n4c3c2)n1 |w:27.28,(10.96,-17.91,;12.5,-17.94,;13.29,-16.62,;14.82,-16.64,;15.57,-17.98,;14.79,-19.31,;13.25,-19.28,;17.12,-18,;18.02,-16.76,;17.4,-15.35,;19.56,-16.92,;20.32,-18.25,;21.83,-17.93,;21.99,-16.41,;23.32,-15.64,;24.66,-16.41,;24.65,-17.95,;25.99,-15.64,;25.99,-14.1,;27.32,-13.33,;28.65,-14.09,;30.12,-13.62,;31.03,-14.86,;32.56,-15.02,;33.47,-13.78,;33.18,-16.44,;32.26,-17.69,;30.73,-17.52,;29.82,-18.75,;30.11,-16.11,;28.65,-15.64,;27.32,-16.41,;20.59,-15.78,)|	InChI=1S/C24H27N5O3S/c1-13-3-7-17(8-4-13)26-22(31)18-12-33-24(27-18)28-21(30)16-6-5-15-9-20-23(32)25-11-14(2)29(20)19(15)10-16/h5-6,9-10,12-14,17H,3-4,7-8,11H2,1-2H3,(H,25,32)(H,26,31)(H,27,28,30)	NLDBMECQYGNKCF-UHFFFAOYSA-N	50374691	CHEMBL437033	MAP kinase-activated protein kinase 2	Homo sapiens		 45							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374691	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374691&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454704	160853781		CHEMBL437033					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862776	CC1CNC(=O)c2cc3ccc(cc3n12)C(=O)Nc1nc(cs1)C(=O)NC1CCOCC1 |w:1.0|	InChI=1S/C22H23N5O4S/c1-12-10-23-21(30)18-8-13-2-3-14(9-17(13)27(12)18)19(28)26-22-25-16(11-32-22)20(29)24-15-4-6-31-7-5-15/h2-3,8-9,11-12,15H,4-7,10H2,1H3,(H,23,30)(H,24,29)(H,25,26,28)	SBSVNMNWUNRGBH-UHFFFAOYSA-N	50374692	CHEMBL272072	MAP kinase-activated protein kinase 2	Homo sapiens		 12							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374692	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374692&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454706	160853782		CHEMBL272072					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862777	CC1CNC(=O)c2cc3ccc(cc3n12)C(=O)Nc1nc(cs1)C(=O)NC1CCN(C)CC1 |w:1.0|	InChI=1S/C23H26N6O3S/c1-13-11-24-22(32)19-9-14-3-4-15(10-18(14)29(13)19)20(30)27-23-26-17(12-33-23)21(31)25-16-5-7-28(2)8-6-16/h3-4,9-10,12-13,16H,5-8,11H2,1-2H3,(H,24,32)(H,25,31)(H,26,27,30)	DZCMVCGUUJNMQE-UHFFFAOYSA-N	50374693	CHEMBL271309	MAP kinase-activated protein kinase 2	Homo sapiens		 5							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374693	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374693&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454732	160853783		CHEMBL271309					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862778	CC1CNC(=O)c2cc3ccc(cc3n12)C(=O)Nc1nc(cs1)C(=O)NC1CCCCC1 |w:1.0|	InChI=1S/C23H25N5O3S/c1-13-11-24-22(31)19-9-14-7-8-15(10-18(14)28(13)19)20(29)27-23-26-17(12-32-23)21(30)25-16-5-3-2-4-6-16/h7-10,12-13,16H,2-6,11H2,1H3,(H,24,31)(H,25,30)(H,26,27,29)	AXEOOGDKIBIWSA-UHFFFAOYSA-N	50374694	CHEMBL409727	MAP kinase-activated protein kinase 2	Homo sapiens		 20							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374694	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374694&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			44454733	160853784		CHEMBL409727					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862779	CC(C)(C)CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC5(CCC5)n4c3c2)n1	InChI=1S/C29H36N6O3S/c1-28(2,3)17-34-11-7-20(8-12-34)31-25(37)21-15-39-27(32-21)33-24(36)19-6-5-18-13-23-26(38)30-16-29(9-4-10-29)35(23)22(18)14-19/h5-6,13-15,20H,4,7-12,16-17H2,1-3H3,(H,30,38)(H,31,37)(H,32,33,36)	MJQUKUIDCUNAAB-UHFFFAOYSA-N	50374681	CHEMBL257834	Mitogen-activated protein kinase 1	Homo sapiens		>3000							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374681	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2239&target=Mitogen-activated+protein+kinase+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374681&enzyme=Mitogen-activated+protein+kinase+1&column=ki&startPg=0&Increment=50&submit=Search			24882562	160853771		CHEMBL257834					1	MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS	8PVU,6G54,4QTE,4QTA,4NIF,4FMQ,2Y9Q,8R5F,8PT5,8PT3,8PT1,8PT0,8PSY,8PSW,8PST,8PSR,7OPM,9LNR,5LCK,4ZXT,4N0S,4G6O,4G6N,4FV9,4FV8,4FV7,4FV6,4FV5,4FV4,4FV3,4FV2,4FV1,4FV0,4FUY,4FUX,3SA0,3I60,3I5Z,2OJJ,2OJI,2OJG,4QPA,4QP9,4QP8,4QP7,4QP6,4QP4,4QP3,4QP2,4QP1,8AOJ,8AOI,8AOH,8AOG,8AOF,8AOE,8AOD,8AOC,8AOB,8AOA,8AO9,8AO8,8AO7,8AO6,8AO5,8AO4,8AO3,8AO2,7XC1,7X4U,7W5O,7NR9,7NR8,7NR5,7NR3,7NQW,7NQQ,7AUV,6RQ4,6QAW,6QAQ,6QAL,6QAH,6QAG,6QA4,6QA3,6QA1,6Q7T,6Q7S,6Q7K,6GJD,6GJB,6GE0,6GDQ,6GDM,6G9N,6G9M,6G9K,6G9J,6G9H,6G9D,6G9A,6G97,6G93,6G92,6G91,6G8X,5LCJ,5AX3,3W55,1WZY,1TVO,5BVF,5BVE,5BVD,5BUJ,5BUI,5BUE,5WP1,8U8K,8U8J,6OPI,6OPH,6OPG,8RQX,8RMB,5V61,5V60,4N4S,4IZA,4IZ7,4I5H,5K4I,8ZJV,5V62,4XJ0,6DMG	Mitogen-activated protein kinase 1	MK01_HUMAN	P28482	A8CZ64																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862780	CC(C)(C)CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC5(CCC5)n4c3c2)n1	InChI=1S/C29H36N6O3S/c1-28(2,3)17-34-11-7-20(8-12-34)31-25(37)21-15-39-27(32-21)33-24(36)19-6-5-18-13-23-26(38)30-16-29(9-4-10-29)35(23)22(18)14-19/h5-6,13-15,20H,4,7-12,16-17H2,1-3H3,(H,30,38)(H,31,37)(H,32,33,36)	MJQUKUIDCUNAAB-UHFFFAOYSA-N	50374681	CHEMBL257834	Mitogen-activated protein kinase kinase kinase 14	Homo sapiens		 480							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374681	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7193&target=Mitogen-activated+protein+kinase+kinase+kinase+14&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374681&enzyme=Mitogen-activated+protein+kinase+kinase+kinase+14&column=ki&startPg=0&Increment=50&submit=Search			24882562	160853771		CHEMBL257834					1	MAVMEMACPGAPGSAVGQQKELPKAKEKTPPLGKKQSSVYKLEAVEKSPVFCGKWEILNDVITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNNVAHATEGKMARVCWKGKRRSKARKKRKKKSSKSLAHAGVALAKPLPRTPEQESCTIPVQEDESPLGAPYVRNTPQFTKPLKEPGLGQLCFKQLGEGLRPALPRSELHKLISPLQCLNHVWKLHHPQDGGPLPLPTHPFPYSRLPHPFPFHPLQPWKPHPLESFLGKLACVDSQKPLPDPHLSKLACVDSPKPLPGPHLEPSCLSRGAHEKFSVEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGGLKSPWRGEYKEPRHPPPNQANYHQTLHAQPRELSPRAPGPRPAEETTGRAPKLQPPLPPEPPEPNKSPPLTLSKEESGMWEPLPLSSLEPAPARNPSSPERKATVPEQELQQLEIELFLNSLSQPFSLEEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSSSWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFSLVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP	4G3D,4IDV,8YHW,7SZR,4G3E,4G3C,6MYN,6G4Z,6G4Y,5T8Q,5T8P,5T8O,4G3G	Mitogen-activated protein kinase kinase kinase 14	M3K14_HUMAN	Q99558	A8K2D8 D3DX67 Q8IYN1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862781	CC(C)(C)CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC5(CCC5)n4c3c2)n1	InChI=1S/C29H36N6O3S/c1-28(2,3)17-34-11-7-20(8-12-34)31-25(37)21-15-39-27(32-21)33-24(36)19-6-5-18-13-23-26(38)30-16-29(9-4-10-29)35(23)22(18)14-19/h5-6,13-15,20H,4,7-12,16-17H2,1-3H3,(H,30,38)(H,31,37)(H,32,33,36)	MJQUKUIDCUNAAB-UHFFFAOYSA-N	50374681	CHEMBL257834	MAP kinase-activated protein kinase 2	Homo sapiens		>30000							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374681	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374681&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			24882562	160853771		CHEMBL257834					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862782	CC(C)(C)CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC5(CCC5)n4c3c2)n1	InChI=1S/C29H36N6O3S/c1-28(2,3)17-34-11-7-20(8-12-34)31-25(37)21-15-39-27(32-21)33-24(36)19-6-5-18-13-23-26(38)30-16-29(9-4-10-29)35(23)22(18)14-19/h5-6,13-15,20H,4,7-12,16-17H2,1-3H3,(H,30,38)(H,31,37)(H,32,33,36)	MJQUKUIDCUNAAB-UHFFFAOYSA-N	50374681	CHEMBL257834	MAP kinase-activated protein kinase 2	Homo sapiens		 710							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374681	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374681&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			24882562	160853771		CHEMBL257834					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862783	CC1CNC(=O)c2[nH]c3ccc(cc3c12)C(=O)Nc1nc(cs1)C(=O)NC1CCN(C)CC1 |w:1.0|	InChI=1S/C23H26N6O3S/c1-12-10-24-22(32)19-18(12)15-9-13(3-4-16(15)26-19)20(30)28-23-27-17(11-33-23)21(31)25-14-5-7-29(2)8-6-14/h3-4,9,11-12,14,26H,5-8,10H2,1-2H3,(H,24,32)(H,25,31)(H,27,28,30)	HPMBJLMHMXBQEW-UHFFFAOYSA-N	50374695	CHEMBL246301	MAP kinase-activated protein kinase 2	Homo sapiens		 10							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374695	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3678&target=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374695&enzyme=MAP+kinase-activated+protein+kinase+2&column=ki&startPg=0&Increment=50&submit=Search			23661566	160853785		CHEMBL246301					1	MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH	2ONL,1NY3,1NXK,1KWP,6TCA,2OZA,4TYH,7NRY,3FYK,3FYJ,2P3G,2JBP,2JBO,3GOK,3WI6,3KC3,3FPM,3A2C,2PZY,3R30,3R2Y,3R2B	MAP kinase-activated protein kinase 2	MAPK2_HUMAN	P49137	Q5SY30 Q5SY41 Q8IYD6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862784	CC(C)(C)CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC5(CCC5)n4c3c2)n1	InChI=1S/C29H36N6O3S/c1-28(2,3)17-34-11-7-20(8-12-34)31-25(37)21-15-39-27(32-21)33-24(36)19-6-5-18-13-23-26(38)30-16-29(9-4-10-29)35(23)22(18)14-19/h5-6,13-15,20H,4,7-12,16-17H2,1-3H3,(H,30,38)(H,31,37)(H,32,33,36)	MJQUKUIDCUNAAB-UHFFFAOYSA-N	50374681	CHEMBL257834	Dual specificity protein kinase CLK1	Homo sapiens		 93							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374681	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4897&target=Dual+specificity+protein+kinase+CLK1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374681&enzyme=Dual+specificity+protein+kinase+CLK1&column=ki&startPg=0&Increment=50&submit=Search			24882562	160853771		CHEMBL257834					1	MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIVFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSDYTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLLKKSI	7OA0,7O9Y,6R8J,6R6X,6R6E,6R3D,6QTY,6FYO	Dual specificity protein kinase CLK1	CLK1_HUMAN	P49759	B4DFW7 Q0P694 Q8N5V8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50862785	CC(C)(C)CN1CCC(CC1)NC(=O)c1csc(NC(=O)c2ccc3cc4C(=O)NCC5(CCC5)n4c3c2)n1	InChI=1S/C29H36N6O3S/c1-28(2,3)17-34-11-7-20(8-12-34)31-25(37)21-15-39-27(32-21)33-24(36)19-6-5-18-13-23-26(38)30-16-29(9-4-10-29)35(23)22(18)14-19/h5-6,13-15,20H,4,7-12,16-17H2,1-3H3,(H,30,38)(H,31,37)(H,32,33,36)	MJQUKUIDCUNAAB-UHFFFAOYSA-N	50374681	CHEMBL257834	Glycogen synthase kinase-3 beta	Homo sapiens		 920							ChEMBL	10.1016/j.bmcl.2007.12.037	10.7270/Q22B8ZWZ	18221871			Goldberg, DR; Choi, Y; Cogan, D; Corson, M; DeLeon, R; Gao, A; Gruenbaum, L; Hao, MH; Joseph, D; Kashem, MA; Miller, C; Moss, N; Netherton, MR; Pargellis, CP; Pelletier, J; Sellati, R; Skow, D; Torcellini, C; Tseng, YC; Wang, J; Wasti, R; Werneburg, B; Wu, JP; Xiong, Z	2/5/2008	12/15/2012	Boehringer Ingelheim Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50374681	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1003&target=Glycogen+synthase+kinase-3+beta&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50374681&enzyme=Glycogen+synthase+kinase-3+beta&column=ki&startPg=0&Increment=50&submit=Search			24882562	160853771		CHEMBL257834					1	MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST	8FF8,8DJE,8DJD,8DJC,4PTG,4PTE,4PTC,4IQ6,4ACH,4ACG,4ACD,4ACC,6V6L,6H0U,6B8J,5OY4,3PUP,3M1S,2JLD,1J1C,1J1B,1I09,5KPM,5KPL,5KPK,5HLP,5HLN,4J71,4J1R,3SAY,3DU8,1PYX,9HV3,9HUL,9HUK,9FR9,9FR8,9FR7,9FR6,9FR5,8XN6,3Q3B,1Q4L,1Q41,1Q3W,1Q3D,6GJO,3L1S,3I4B,1Q5K,1R0E,4NU1,4NM3,4NM0,4NM7,4NM5,3ZRM,3ZRL,3ZRK,1GNG,4AFJ,6GN1,2O5K,8VMG,8VMF,8VME,8QJI,7Z1G,7Z1F,8AV1,8AUZ,7B6F,9PE9,9X2Y,9X2X,9X2W,9X2V,9X2U,9X2Q,5K5N,6TCU,2OW3,7U36,7U33,7OY5,3GB2,7U31,7SXJ,5F95,5F94,6Y9S,6Y9R,6HK4,6HK3,4B7T,3ZDI,3SD0,3F7Z,7U2Z,7SXH,6HK7	Glycogen synthase kinase-3 beta	GSK3B_HUMAN	P49841	D3DN89 Q9BWH3 Q9UL47		Glycogen synthase kinase-3 beta	Q6FI27_HUMAN	Q6FI27	D3DN88																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																													
