BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51165551 Brc1ccc(C(=O)N2CCCCC2)c(NS(=O)(=O)c2ccc(CNC(=O)c3ccccc3)s2)c1 InChI=1S/C24H24BrN3O4S2/c25-18-9-11-20(24(30)28-13-5-2-6-14-28)21(15-18)27-34(31,32)22-12-10-19(33-22)16-26-23(29)17-7-3-1-4-8-17/h1,3-4,7-12,15,27H,2,5-6,13-14,16H2,(H,26,29) HTEGPOXMWMUCGU-UHFFFAOYSA-N 50477803 CHEMBL249452 Gastrin/cholecystokinin type B receptor Homo sapiens 6310 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477803 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477803&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 44445283 433945068 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165552 Brc1ccc(C(=O)N2CCCCC2)c(NS(=O)(=O)c2cccc3nsnc23)c1 InChI=1S/C18H17BrN4O3S2/c19-12-7-8-13(18(24)23-9-2-1-3-10-23)15(11-12)22-28(25,26)16-6-4-5-14-17(16)21-27-20-14/h4-8,11,22H,1-3,9-10H2 UAZJILXGKNHGJZ-UHFFFAOYSA-N 50196190 1-[2-[(2,1,3-benzothiadiazol-4-ylsulfonyl)amino]-4-bromobenzoyl]-piperidine::N-(5-bromo-2-(piperidine-1-carbonyl)phenyl)benzo[c][1,2,5]thiadiazole-4-sulfonamide::[5-bromo-2-(piperidine-1-carbonyl)phenyl] amide::CHEMBL217453 Gastrin/cholecystokinin type B receptor Homo sapiens 25 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50196190 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50196190&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 9913081 104078066 CHEMBL217453 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165553 Fc1cccc(F)c1S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C18H17BrF2N2O3S/c19-12-7-8-13(18(24)23-9-2-1-3-10-23)16(11-12)22-27(25,26)17-14(20)5-4-6-15(17)21/h4-8,11,22H,1-3,9-10H2 CEZDOZMPJGOTJA-UHFFFAOYSA-N 50477804 CHEMBL251466 Gastrin/cholecystokinin type B receptor Homo sapiens 501 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477804 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477804&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 24755148 433945069 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165554 FC(F)(F)c1cc(no1)-c1ccc(s1)S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C20H17BrF3N3O4S2/c21-12-4-5-13(19(28)27-8-2-1-3-9-27)14(10-12)26-33(29,30)18-7-6-16(32-18)15-11-17(31-25-15)20(22,23)24/h4-7,10-11,26H,1-3,8-9H2 SZJFKNMQBFKHIP-UHFFFAOYSA-N 50477805 CHEMBL400165 Gastrin/cholecystokinin type B receptor Homo sapiens 5012 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477805 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477805&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033310 433945070 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165555 Cc1nnc(o1)-c1cccc(c1)S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C21H21BrN4O4S/c1-14-23-24-20(30-14)15-6-5-7-17(12-15)31(28,29)25-19-13-16(22)8-9-18(19)21(27)26-10-3-2-4-11-26/h5-9,12-13,25H,2-4,10-11H2,1H3 MTXUGOPELQSDDX-UHFFFAOYSA-N 50477806 CHEMBL251653 Gastrin/cholecystokinin type B receptor Homo sapiens 7943 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477806 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477806&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033384 433945071 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165556 COC(=O)c1cc(oc1C)S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C19H21BrN2O6S/c1-12-15(19(24)27-2)11-17(28-12)29(25,26)21-16-10-13(20)6-7-14(16)18(23)22-8-4-3-5-9-22/h6-7,10-11,21H,3-5,8-9H2,1-2H3 VZGWJCSFLVDNOA-UHFFFAOYSA-N 50477807 CHEMBL400114 Gastrin/cholecystokinin type B receptor Homo sapiens 5012 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477807 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477807&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033226 433945072 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165557 Cc1ccc(cc1[N+]([O-])=O)S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C19H20BrN3O5S/c1-13-5-7-15(12-18(13)23(25)26)29(27,28)21-17-11-14(20)6-8-16(17)19(24)22-9-3-2-4-10-22/h5-8,11-12,21H,2-4,9-10H2,1H3 WQEMYKRXRWVIQN-UHFFFAOYSA-N 50477808 CHEMBL251651 Gastrin/cholecystokinin type B receptor Homo sapiens 1995 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477808 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477808&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 44445282 433945073 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165558 Clc1nc2sccn2c1S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C17H16BrClN4O3S2/c18-11-4-5-12(15(24)22-6-2-1-3-7-22)13(10-11)21-28(25,26)16-14(19)20-17-23(16)8-9-27-17/h4-5,8-10,21H,1-3,6-7H2 NQXNMNWIMOHNIE-UHFFFAOYSA-N 50477809 CHEMBL251684 Gastrin/cholecystokinin type B receptor Homo sapiens 1585 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477809 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477809&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033153 433945074 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165559 Brc1ccc(C(=O)N2CCCCC2)c(NS(=O)(=O)c2cccc(c2)C#N)c1 InChI=1S/C19H18BrN3O3S/c20-15-7-8-17(19(24)23-9-2-1-3-10-23)18(12-15)22-27(25,26)16-6-4-5-14(11-16)13-21/h4-8,11-12,22H,1-3,9-10H2 PNOHDFPZQQOFLD-UHFFFAOYSA-N 50477810 CHEMBL251652 Gastrin/cholecystokinin type B receptor Homo sapiens 5012 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477810 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477810&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033309 433945075 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165560 CSc1nccc(n1)-c1ccc(s1)S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C21H21BrN4O3S3/c1-30-21-23-10-9-16(24-21)18-7-8-19(31-18)32(28,29)25-17-13-14(22)5-6-15(17)20(27)26-11-3-2-4-12-26/h5-10,13,25H,2-4,11-12H2,1H3 QBHJUDJJJPOAHK-UHFFFAOYSA-N 50477811 CHEMBL251485 Gastrin/cholecystokinin type B receptor Homo sapiens 3162 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477811 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477811&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033306 433945076 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165561 COC(=O)c1csc(c1OC)S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C19H21BrN2O6S2/c1-27-16-14(18(24)28-2)11-29-19(16)30(25,26)21-15-10-12(20)6-7-13(15)17(23)22-8-4-3-5-9-22/h6-7,10-11,21H,3-5,8-9H2,1-2H3 JDGOYAGNVTZMEO-UHFFFAOYSA-N 50477812 CHEMBL400164 Gastrin/cholecystokinin type B receptor Homo sapiens 5012 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477812 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477812&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 24983506 433945077 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165562 COC(=O)c1c(C)oc(C)c1S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C20H23BrN2O6S/c1-12-17(20(25)28-3)18(13(2)29-12)30(26,27)22-16-11-14(21)7-8-15(16)19(24)23-9-5-4-6-10-23/h7-8,11,22H,4-6,9-10H2,1-3H3 UIPPRWRZTMNCJA-UHFFFAOYSA-N 50477813 CHEMBL249469 Gastrin/cholecystokinin type B receptor Homo sapiens 501 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477813 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477813&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033380 433945078 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165563 COC(=O)c1sccc1S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C18H19BrN2O5S2/c1-26-18(23)16-15(7-10-27-16)28(24,25)20-14-11-12(19)5-6-13(14)17(22)21-8-3-2-4-9-21/h5-7,10-11,20H,2-4,8-9H2,1H3 ASIDPENANBAGQB-UHFFFAOYSA-N 50477814 CHEMBL399918 Gastrin/cholecystokinin type B receptor Homo sapiens 1585 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477814 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477814&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033227 433945079 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165564 COC(=O)c1sc(c(c1S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1)-c1ccccc1)C(F)(F)F InChI=1S/C25H22BrF3N2O5S2/c1-36-24(33)20-21(19(15-8-4-2-5-9-15)22(37-20)25(27,28)29)38(34,35)30-18-14-16(26)10-11-17(18)23(32)31-12-6-3-7-13-31/h2,4-5,8-11,14,30H,3,6-7,12-13H2,1H3 HCHCIXCNRKUIPV-UHFFFAOYSA-N 50477815 CHEMBL249468 Gastrin/cholecystokinin type B receptor Homo sapiens 7943 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477815 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477815&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033382 433945080 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165565 Brc1ccc(C(=O)N2CCCCC2)c(NS(=O)(=O)c2ccc3OCCCOc3c2)c1 InChI=1S/C21H23BrN2O5S/c22-15-5-7-17(21(25)24-9-2-1-3-10-24)18(13-15)23-30(26,27)16-6-8-19-20(14-16)29-12-4-11-28-19/h5-8,13-14,23H,1-4,9-12H2 GHOYVTHDVNIQEL-UHFFFAOYSA-N 50477816 CHEMBL399059 Gastrin/cholecystokinin type B receptor Homo sapiens 2512 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477816 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477816&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033229 433945081 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165566 Clc1ccc(NS(=O)(=O)c2cccc3nsnc23)c(c1)C(=O)N1CCCCC1 InChI=1S/C18H17ClN4O3S2/c19-12-7-8-14(13(11-12)18(24)23-9-2-1-3-10-23)22-28(25,26)16-6-4-5-15-17(16)21-27-20-15/h4-8,11,22H,1-3,9-10H2 IGEXLXUBRNEZLP-UHFFFAOYSA-N 50477817 CHEMBL387285 Gastrin/cholecystokinin type B receptor Homo sapiens 398 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477817 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477817&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 1098327 433945082 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165567 Brc1ccc(C(=O)N2CCCCC2)c(NS(=O)(=O)c2csc3ccccc23)c1 InChI=1S/C20H19BrN2O3S2/c21-14-8-9-15(20(24)23-10-4-1-5-11-23)17(12-14)22-28(25,26)19-13-27-18-7-3-2-6-16(18)19/h2-3,6-9,12-13,22H,1,4-5,10-11H2 PZANVDQHHJDIHD-UHFFFAOYSA-N 50477818 CHEMBL399919 Gastrin/cholecystokinin type B receptor Homo sapiens 3162 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477818 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477818&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033305 433945083 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165568 Clc1cc(Br)c(s1)S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C16H15Br2ClN2O3S2/c17-10-4-5-11(15(22)21-6-2-1-3-7-21)13(8-10)20-26(23,24)16-12(18)9-14(19)25-16/h4-5,8-9,20H,1-3,6-7H2 SLBONUXSXZOLGP-UHFFFAOYSA-N 50477819 CHEMBL251486 Gastrin/cholecystokinin type B receptor Homo sapiens 794 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477819 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477819&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033225 433945084 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165569 Cc1c(cnn1-c1ccccc1)S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C22H23BrN4O3S/c1-16-21(15-24-27(16)18-8-4-2-5-9-18)31(29,30)25-20-14-17(23)10-11-19(20)22(28)26-12-6-3-7-13-26/h2,4-5,8-11,14-15,25H,3,6-7,12-13H2,1H3 YZOVMEGJMAQNJO-UHFFFAOYSA-N 50477820 CHEMBL429662 Gastrin/cholecystokinin type B receptor Homo sapiens 7943 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477820 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477820&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033383 433945085 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165570 Cc1nc(cs1)-c1ccc(s1)S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C20H20BrN3O3S3/c1-13-22-17(12-28-13)18-7-8-19(29-18)30(26,27)23-16-11-14(21)5-6-15(16)20(25)24-9-3-2-4-10-24/h5-8,11-12,23H,2-4,9-10H2,1H3 RICOSWZFJRUUQJ-UHFFFAOYSA-N 50477821 CHEMBL251655 Gastrin/cholecystokinin type B receptor Homo sapiens 3981 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477821 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477821&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033307 433945086 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165571 FC(F)(F)c1ccc(c(Cl)c1)S(=O)(=O)Nc1cc(Br)ccc1C(=O)N1CCCCC1 InChI=1S/C19H17BrClF3N2O3S/c20-13-5-6-14(18(27)26-8-2-1-3-9-26)16(11-13)25-30(28,29)17-7-4-12(10-15(17)21)19(22,23)24/h4-7,10-11,25H,1-3,8-9H2 LZCPCYZMWRPZJO-UHFFFAOYSA-N 50477822 CHEMBL251467 Gastrin/cholecystokinin type B receptor Homo sapiens 631 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477822 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477822&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 25033224 433945087 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165572 Brc1ccc(C(=O)N2CCCCC2)c(NS(=O)(=O)c2ccc3nsnc3c2)c1 InChI=1S/C18H17BrN4O3S2/c19-12-4-6-14(18(24)23-8-2-1-3-9-23)16(10-12)22-28(25,26)13-5-7-15-17(11-13)21-27-20-15/h4-7,10-11,22H,1-3,8-9H2 NXOJBHPTOAAHMH-UHFFFAOYSA-N 50196208 N-(5-bromo-2-(piperidine-1-carbonyl)phenyl)benzo[c][1,2,5]thiadiazole-5-sulfonamide::1-[2-[(2,1,3-benzothiadiazol-5-ylsulfonyl)amino]-4-bromobenzoyl]-piperidine::CHEMBL387299 Gastrin/cholecystokinin type B receptor Homo sapiens 5012 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50196208 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2126&target=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50196208&enzyme=Gastrin%2Fcholecystokinin+type+B+receptor&column=ki&startPg=0&Increment=50&submit=Search 16090782 104078084 CHEMBL387299 1 MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG 8IA7,7XOW Gastrin/cholecystokinin type B receptor GASR_HUMAN P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 51165573 Clc1ccc(NS(=O)(=O)c2cccc3nsnc23)c(c1)C(=O)N1CCCCC1 InChI=1S/C18H17ClN4O3S2/c19-12-7-8-14(13(11-12)18(24)23-9-2-1-3-10-23)22-28(25,26)16-6-4-5-15-17(16)21-27-20-15/h4-8,11,22H,1-3,9-10H2 IGEXLXUBRNEZLP-UHFFFAOYSA-N 50477817 CHEMBL387285 Cholecystokinin receptor type A Homo sapiens <10000 ChEMBL 10.1016/j.bmcl.2007.09.087 10.7270/Q2G73HJW 18029172 Woods, CR; Hack, MD; Allison, BD; Phuong, VK; Rosen, MD; Morton, MF; Prendergast, CE; Barrett, TD; Shankley, NP; Rabinowitz, MH 12/15/2007 8/24/2020 Johnson & Johnson Pharmaceutical Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50477817 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50477817&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search 1098327 433945082 1 MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ 7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY Cholecystokinin receptor type A CCKAR_HUMAN P32238 B2R9Z5