BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50382851 COc1ccc(Cl)cc1CC1CNC(=O)CN(C(=O)NC(c2ccccc2)c2ccccc2)C1=O InChI=1S/C27H26ClN3O4/c1-35-23-13-12-22(28)15-20(23)14-21-16-29-24(32)17-31(26(21)33)27(34)30-25(18-8-4-2-5-9-18)19-10-6-3-7-11-19/h2-13,15,21,25H,14,16-17H2,1H3,(H,29,32)(H,30,34) RCAVKMAZWPXDRK-UHFFFAOYSA-N 50210723 6-(5-chloro-2-methoxybenzyl)-N-benzhydryl-3,7-dioxo-1,4-diazepane-1-carboxamide::CHEMBL396301 Chymase Homo sapiens >100000 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210723 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210723&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440023 104087174 CHEMBL396301 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382852 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1cccc(c1)C(O)=O InChI=1S/C24H26ClN3O6/c1-3-19(14-5-4-6-15(9-14)23(31)32)27-24(33)28-13-21(29)26-12-17(22(28)30)10-16-11-18(25)7-8-20(16)34-2/h4-9,11,17,19H,3,10,12-13H2,1-2H3,(H,26,29)(H,27,33)(H,31,32) TUWGPTVZDXFRTK-UHFFFAOYSA-N 50210724 3-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoic acid::CHEMBL248180 Chymase Homo sapiens 540 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210724 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210724&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440030 104087175 CHEMBL248180 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382853 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(O)c(c1)C(O)=O InChI=1S/C24H26ClN3O7/c1-3-18(13-4-6-19(29)17(10-13)23(32)33)27-24(34)28-12-21(30)26-11-15(22(28)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,18,29H,3,8,11-12H2,1-2H3,(H,26,30)(H,27,34)(H,32,33) CYUDVVQWJVHMGL-UHFFFAOYSA-N 50210725 5-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-hydroxybenzoic acid::CHEMBL396333 Chymase Homo sapiens 410 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210725 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210725&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440034 104087176 CHEMBL396333 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382854 COc1ccc(Cl)cc1CC1CNC(=O)CN(C(=O)N(C)Cc2ccccc2)C1=O InChI=1S/C22H24ClN3O4/c1-25(13-15-6-4-3-5-7-15)22(29)26-14-20(27)24-12-17(21(26)28)10-16-11-18(23)8-9-19(16)30-2/h3-9,11,17H,10,12-14H2,1-2H3,(H,24,27) FDOGVSPRPKTQRK-UHFFFAOYSA-N 50210726 6-(5-chloro-2-methoxybenzyl)-N-benzyl-N-methyl-3,7-dioxo-1,4-diazepane-1-carboxamide::CHEMBL398023 Chymase Homo sapiens >100000 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210726 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210726&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440011 104087177 CHEMBL398023 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382855 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(cc1)C(=O)OC InChI=1S/C25H28ClN3O6/c1-4-20(15-5-7-16(8-6-15)24(32)35-3)28-25(33)29-14-22(30)27-13-18(23(29)31)11-17-12-19(26)9-10-21(17)34-2/h5-10,12,18,20H,4,11,13-14H2,1-3H3,(H,27,30)(H,28,33) NETBAEWIBGVYTD-UHFFFAOYSA-N 50210727 methyl 4-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoate::CHEMBL396302 Chymase Homo sapiens 2500 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210727 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210727&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440025 104087178 CHEMBL396302 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382856 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccccc1 InChI=1S/C23H26ClN3O4/c1-3-19(15-7-5-4-6-8-15)26-23(30)27-14-21(28)25-13-17(22(27)29)11-16-12-18(24)9-10-20(16)31-2/h4-10,12,17,19H,3,11,13-14H2,1-2H3,(H,25,28)(H,26,30) NRABXXLHOILLKP-UHFFFAOYSA-N 50210728 6-(5-chloro-2-methoxybenzyl)-3,7-dioxo-N-(1-phenylpropyl)-1,4-diazepane-1-carboxamide::CHEMBL245752 Chymase Homo sapiens 2800 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210728 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210728&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440020 104087179 CHEMBL245752 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382857 CCCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccccc1 InChI=1S/C24H28ClN3O4/c1-3-7-20(16-8-5-4-6-9-16)27-24(31)28-15-22(29)26-14-18(23(28)30)12-17-13-19(25)10-11-21(17)32-2/h4-6,8-11,13,18,20H,3,7,12,14-15H2,1-2H3,(H,26,29)(H,27,31) FPGZCSVYHUQWFB-UHFFFAOYSA-N 50210732 6-(5-chloro-2-methoxybenzyl)-3,7-dioxo-N-(1-phenylbutyl)-1,4-diazepane-1-carboxamide::CHEMBL391821 Chymase Homo sapiens 69300 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210732 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210732&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440022 104087183 CHEMBL391821 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382858 CC[C@H](NC(=O)N1CC(=O)NC[C@@H](Cc2cc(Cl)ccc2OC)C1=O)c1ccc(C(O)=O)c(N)c1 InChI=1S/C24H27ClN4O6/c1-3-19(13-4-6-17(23(32)33)18(26)10-13)28-24(34)29-12-21(30)27-11-15(22(29)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,19H,3,8,11-12,26H2,1-2H3,(H,27,30)(H,28,34)(H,32,33) ZQCPJAZKZATEMD-UHFFFAOYSA-N 50210734 4-((S)-1-((R)-6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-aminobenzoic acid::CHEMBL395206 Chymase Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210734 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210734&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440078 104087185 CHEMBL395206 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382859 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(C(O)=O)c(O)c1 InChI=1S/C24H26ClN3O7/c1-3-18(13-4-6-17(23(32)33)19(29)10-13)27-24(34)28-12-21(30)26-11-15(22(28)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,18,29H,3,8,11-12H2,1-2H3,(H,26,30)(H,27,34)(H,32,33) RRZMDBDMNHCIGY-UHFFFAOYSA-N 50210733 4-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-hydroxybenzoic acid::CHEMBL247975 Chymase Homo sapiens 460 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210733 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210733&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440026 104087184 CHEMBL247975 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382860 CC[C@@H](NC(=O)N1CC(=O)NC[C@@H](Cc2cc(Cl)ccc2OC)C1=O)c1cccc(c1)C(O)=O InChI=1S/C24H26ClN3O6/c1-3-19(14-5-4-6-15(9-14)23(31)32)27-24(33)28-13-21(29)26-12-17(22(28)30)10-16-11-18(25)7-8-20(16)34-2/h4-9,11,17,19H,3,10,12-13H2,1-2H3,(H,26,29)(H,27,33)(H,31,32) TUWGPTVZDXFRTK-UHFFFAOYSA-N 50210729 3-((R)-1-((R)-6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoic acid::CHEMBL245532 Chymase Homo sapiens 240 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210729 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210729&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 11684537 104087180 CHEMBL245532 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382861 CC[C@@H](NC(=O)N1CC(=O)NC[C@@H](Cc2cc(Cl)ccc2OC)C1=O)c1ccc(C(O)=O)c(N)c1 InChI=1S/C24H27ClN4O6/c1-3-19(13-4-6-17(23(32)33)18(26)10-13)28-24(34)29-12-21(30)27-11-15(22(29)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,19H,3,8,11-12,26H2,1-2H3,(H,27,30)(H,28,34)(H,32,33) ZQCPJAZKZATEMD-UHFFFAOYSA-N 50210730 4-((R)-1-((R)-6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-aminobenzoic acid::CHEMBL245930 Cathepsin G Homo sapiens 16000 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210730 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210730&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 11540629 104087181 CHEMBL245930 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50382862 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(N)c(c1)C(O)=O InChI=1S/C24H27ClN4O6/c1-3-19(13-4-6-18(26)17(10-13)23(32)33)28-24(34)29-12-21(30)27-11-15(22(29)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,19H,3,8,11-12,26H2,1-2H3,(H,27,30)(H,28,34)(H,32,33) OYVJDRQTBBCOBT-UHFFFAOYSA-N 50210735 5-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-aminobenzoic acid::CHEMBL245360 Chymase Homo sapiens 630 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210735 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210735&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440035 104087186 CHEMBL245360 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382863 COc1ccc(Cl)cc1CC1CNC(=O)CN(C(=O)NC(C(C)C)c2ccccc2)C1=O InChI=1S/C24H28ClN3O4/c1-15(2)22(16-7-5-4-6-8-16)27-24(31)28-14-21(29)26-13-18(23(28)30)11-17-12-19(25)9-10-20(17)32-3/h4-10,12,15,18,22H,11,13-14H2,1-3H3,(H,26,29)(H,27,31) COFWZNRGTQJFDE-UHFFFAOYSA-N 50210736 6-(5-chloro-2-methoxybenzyl)-N-(2-methyl-1-phenylpropyl)-3,7-dioxo-1,4-diazepane-1-carboxamide::CHEMBL245753 Chymase Homo sapiens 3000 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210736 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210736&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440021 104087187 CHEMBL245753 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382864 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(N)c(c1)C(O)=O InChI=1S/C24H27ClN4O6/c1-3-19(13-4-6-18(26)17(10-13)23(32)33)28-24(34)29-12-21(30)27-11-15(22(29)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,19H,3,8,11-12,26H2,1-2H3,(H,27,30)(H,28,34)(H,32,33) OYVJDRQTBBCOBT-UHFFFAOYSA-N 50210735 5-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-aminobenzoic acid::CHEMBL245360 Chymase Homo sapiens 630 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210735 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210735&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440035 104087186 CHEMBL245360 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382865 CC[C@@H](NC(=O)N1CC(=O)NC[C@@H](Cc2cc(Cl)ccc2OC)C1=O)c1cccc(c1)C(O)=O InChI=1S/C24H26ClN3O6/c1-3-19(14-5-4-6-15(9-14)23(31)32)27-24(33)28-13-21(29)26-12-17(22(28)30)10-16-11-18(25)7-8-20(16)34-2/h4-9,11,17,19H,3,10,12-13H2,1-2H3,(H,26,29)(H,27,33)(H,31,32) TUWGPTVZDXFRTK-UHFFFAOYSA-N 50210729 3-((R)-1-((R)-6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoic acid::CHEMBL245532 Cathepsin G Homo sapiens 8000 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210729 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210729&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 11684537 104087180 CHEMBL245532 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50382866 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1cccc(c1)C(O)=O InChI=1S/C24H26ClN3O6/c1-3-19(14-5-4-6-15(9-14)23(31)32)27-24(33)28-13-21(29)26-12-17(22(28)30)10-16-11-18(25)7-8-20(16)34-2/h4-9,11,17,19H,3,10,12-13H2,1-2H3,(H,26,29)(H,27,33)(H,31,32) TUWGPTVZDXFRTK-UHFFFAOYSA-N 50210724 3-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoic acid::CHEMBL248180 Chymase Homo sapiens 540 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210724 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210724&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440030 104087175 CHEMBL248180 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382867 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(cc1)C(=O)OC InChI=1S/C25H28ClN3O6/c1-4-20(15-5-7-16(8-6-15)24(32)35-3)28-25(33)29-14-22(30)27-13-18(23(29)31)11-17-12-19(26)9-10-21(17)34-2/h5-10,12,18,20H,4,11,13-14H2,1-3H3,(H,27,30)(H,28,33) NETBAEWIBGVYTD-UHFFFAOYSA-N 50210727 methyl 4-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoate::CHEMBL396302 Chymase Homo sapiens 2500 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210727 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210727&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440025 104087178 CHEMBL396302 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382868 CC[C@@H](NC(=O)N1CC(=O)NC[C@H](Cc2cc(Cl)ccc2OC)C1=O)c1ccc(C(O)=O)c(N)c1 |r| InChI=1S/C24H27ClN4O6/c1-3-19(13-4-6-17(23(32)33)18(26)10-13)28-24(34)29-12-21(30)27-11-15(22(29)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,19H,3,8,11-12,26H2,1-2H3,(H,27,30)(H,28,34)(H,32,33) ZQCPJAZKZATEMD-UHFFFAOYSA-N 100746 US8507714, 277::US8507714, 150::CHEMBL246560 Chymase Homo sapiens 170 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=100746 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=100746&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 11634767 165223207 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382869 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1cccc(c1)C(=O)OC InChI=1S/C25H28ClN3O6/c1-4-20(15-6-5-7-16(10-15)24(32)35-3)28-25(33)29-14-22(30)27-13-18(23(29)31)11-17-12-19(26)8-9-21(17)34-2/h5-10,12,18,20H,4,11,13-14H2,1-3H3,(H,27,30)(H,28,33) XAXIRVCTHOAVME-UHFFFAOYSA-N 50210737 methyl 3-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoate::CHEMBL248181 Chymase Homo sapiens 2600 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210737 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210737&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440032 104087188 CHEMBL248181 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382870 COc1ccc(Cl)cc1CC1CNC(=O)CN(C(=O)NC(C)c2ccccc2)C1=O InChI=1S/C22H24ClN3O4/c1-14(15-6-4-3-5-7-15)25-22(29)26-13-20(27)24-12-17(21(26)28)10-16-11-18(23)8-9-19(16)30-2/h3-9,11,14,17H,10,12-13H2,1-2H3,(H,24,27)(H,25,29) GPEPQPOPJWAZHO-UHFFFAOYSA-N 50210738 6-(5-chloro-2-methoxybenzyl)-3,7-dioxo-N-(1-phenylethyl)-1,4-diazepane-1-carboxamide::CHEMBL246155 Chymase Homo sapiens 5300 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210738 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210738&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440019 104087189 CHEMBL246155 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382871 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(C(O)=O)c(O)c1 InChI=1S/C24H26ClN3O7/c1-3-18(13-4-6-17(23(32)33)19(29)10-13)27-24(34)28-12-21(30)26-11-15(22(28)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,18,29H,3,8,11-12H2,1-2H3,(H,26,30)(H,27,34)(H,32,33) RRZMDBDMNHCIGY-UHFFFAOYSA-N 50210733 4-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-hydroxybenzoic acid::CHEMBL247975 Chymase Homo sapiens 460 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210733 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210733&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440026 104087184 CHEMBL247975 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382872 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1cccc(c1)C(=O)OC InChI=1S/C25H28ClN3O6/c1-4-20(15-6-5-7-16(10-15)24(32)35-3)28-25(33)29-14-22(30)27-13-18(23(29)31)11-17-12-19(26)8-9-21(17)34-2/h5-10,12,18,20H,4,11,13-14H2,1-3H3,(H,27,30)(H,28,33) XAXIRVCTHOAVME-UHFFFAOYSA-N 50210737 methyl 3-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoate::CHEMBL248181 Chymase Homo sapiens 2600 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210737 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210737&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440032 104087188 CHEMBL248181 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382873 CC[C@H](NC(=O)N1CC(=O)NC[C@H](Cc2cc(Cl)ccc2OC)C1=O)c1ccc(C(O)=O)c(N)c1 InChI=1S/C24H27ClN4O6/c1-3-19(13-4-6-17(23(32)33)18(26)10-13)28-24(34)29-12-21(30)27-11-15(22(29)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,19H,3,8,11-12,26H2,1-2H3,(H,27,30)(H,28,34)(H,32,33) ZQCPJAZKZATEMD-UHFFFAOYSA-N 50210739 4-((S)-1-((S)-6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-aminobenzoic acid::CHEMBL397126 Chymase Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210739 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210739&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440066 104087190 CHEMBL397126 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382874 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(C(O)=O)c(N)c1 InChI=1S/C24H27ClN4O6/c1-3-19(13-4-6-17(23(32)33)18(26)10-13)28-24(34)29-12-21(30)27-11-15(22(29)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,19H,3,8,11-12,26H2,1-2H3,(H,27,30)(H,28,34)(H,32,33) ZQCPJAZKZATEMD-UHFFFAOYSA-N 50210740 4-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-aminobenzoic acid::CHEMBL394641 Chymase Homo sapiens 500 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210740 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210740&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440027 104087191 CHEMBL394641 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382875 CC[C@@H](NC(=O)N1CC(=O)NC[C@@H](Cc2cc(Cl)ccc2OC)C1=O)c1ccc(C(O)=O)c(N)c1 InChI=1S/C24H27ClN4O6/c1-3-19(13-4-6-17(23(32)33)18(26)10-13)28-24(34)29-12-21(30)27-11-15(22(29)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,19H,3,8,11-12,26H2,1-2H3,(H,27,30)(H,28,34)(H,32,33) ZQCPJAZKZATEMD-UHFFFAOYSA-N 50210730 4-((R)-1-((R)-6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-aminobenzoic acid::CHEMBL245930 Chymase Homo sapiens 300 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210730 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210730&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 11540629 104087181 CHEMBL245930 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382876 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(C(O)=O)c(N)c1 InChI=1S/C24H27ClN4O6/c1-3-19(13-4-6-17(23(32)33)18(26)10-13)28-24(34)29-12-21(30)27-11-15(22(29)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,19H,3,8,11-12,26H2,1-2H3,(H,27,30)(H,28,34)(H,32,33) ZQCPJAZKZATEMD-UHFFFAOYSA-N 50210740 4-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-aminobenzoic acid::CHEMBL394641 Chymase Homo sapiens 500 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210740 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210740&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440027 104087191 CHEMBL394641 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382877 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(cc1)C(O)=O InChI=1S/C24H26ClN3O6/c1-3-19(14-4-6-15(7-5-14)23(31)32)27-24(33)28-13-21(29)26-12-17(22(28)30)10-16-11-18(25)8-9-20(16)34-2/h4-9,11,17,19H,3,10,12-13H2,1-2H3,(H,26,29)(H,27,33)(H,31,32) FRLHVSYQUWWEIJ-UHFFFAOYSA-N 50210741 4-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoic acid::CHEMBL247779 Chymase Homo sapiens 470 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210741 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210741&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440024 104087192 CHEMBL247779 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382878 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(cc1)C(O)=O InChI=1S/C24H26ClN3O6/c1-3-19(14-4-6-15(7-5-14)23(31)32)27-24(33)28-13-21(29)26-12-17(22(28)30)10-16-11-18(25)8-9-20(16)34-2/h4-9,11,17,19H,3,10,12-13H2,1-2H3,(H,26,29)(H,27,33)(H,31,32) FRLHVSYQUWWEIJ-UHFFFAOYSA-N 50210741 4-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoic acid::CHEMBL247779 Chymase Homo sapiens 470 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210741 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210741&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440024 104087192 CHEMBL247779 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382879 CC[C@@H](NC(=O)N1CC(=O)NC[C@H](Cc2cc(Cl)ccc2OC)C1=O)c1ccc(C(O)=O)c(N)c1 |r| InChI=1S/C24H27ClN4O6/c1-3-19(13-4-6-17(23(32)33)18(26)10-13)28-24(34)29-12-21(30)27-11-15(22(29)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,19H,3,8,11-12,26H2,1-2H3,(H,27,30)(H,28,34)(H,32,33) ZQCPJAZKZATEMD-UHFFFAOYSA-N 100746 US8507714, 277::US8507714, 150::CHEMBL246560 Cathepsin G Homo sapiens 28000 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=100746 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=100746&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 11634767 165223207 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50382880 CCC(NC(=O)N1CC(=O)NCC(Cc2cc(Cl)ccc2OC)C1=O)c1ccc(O)c(c1)C(O)=O InChI=1S/C24H26ClN3O7/c1-3-18(13-4-6-19(29)17(10-13)23(32)33)27-24(34)28-12-21(30)26-11-15(22(28)31)8-14-9-16(25)5-7-20(14)35-2/h4-7,9-10,15,18,29H,3,8,11-12H2,1-2H3,(H,26,30)(H,27,34)(H,32,33) CYUDVVQWJVHMGL-UHFFFAOYSA-N 50210725 5-(1-(6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)-2-hydroxybenzoic acid::CHEMBL396333 Chymase Homo sapiens 410 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210725 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210725&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440034 104087176 CHEMBL396333 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382881 COc1ccc(Cl)cc1CC1CNC(=O)CN(C(=O)NCCc2ccccc2)C1=O InChI=1S/C22H24ClN3O4/c1-30-19-8-7-18(23)12-16(19)11-17-13-25-20(27)14-26(21(17)28)22(29)24-10-9-15-5-3-2-4-6-15/h2-8,12,17H,9-11,13-14H2,1H3,(H,24,29)(H,25,27) AZUIGDSCANRXNY-UHFFFAOYSA-N 50210744 6-(5-chloro-2-methoxybenzyl)-3,7-dioxo-N-phenethyl-1,4-diazepane-1-carboxamide::CHEMBL247373 Chymase Homo sapiens 44500 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210744 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210744&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440014 104087195 CHEMBL247373 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382882 CC[C@H](NC(=O)N1CC(=O)NC[C@H](Cc2cc(Cl)ccc2OC)C1=O)c1cccc(c1)C(O)=O InChI=1S/C24H26ClN3O6/c1-3-19(14-5-4-6-15(9-14)23(31)32)27-24(33)28-13-21(29)26-12-17(22(28)30)10-16-11-18(25)7-8-20(16)34-2/h4-9,11,17,19H,3,10,12-13H2,1-2H3,(H,26,29)(H,27,33)(H,31,32) TUWGPTVZDXFRTK-UHFFFAOYSA-N 50210745 3-((S)-1-((S)-6-(5-chloro-2-methoxybenzyl)-2,5-dioxo-1,4-diazepane-4-carboxamido)propyl)benzoic acid::CHEMBL245731 Chymase Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210745 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210745&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440082 104087196 CHEMBL245731 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382883 COc1ccc(Cl)cc1CC1CNC(=O)CN(C(=O)NCc2ccccc2)C1=O InChI=1S/C21H22ClN3O4/c1-29-18-8-7-17(22)10-15(18)9-16-12-23-19(26)13-25(20(16)27)21(28)24-11-14-5-3-2-4-6-14/h2-8,10,16H,9,11-13H2,1H3,(H,23,26)(H,24,28) MKRPSCWOLGVVEX-UHFFFAOYSA-N 50210742 6-(5-chloro-2-methoxybenzyl)-N-benzyl-3,7-dioxo-1,4-diazepane-1-carboxamide::CHEMBL247371 Chymase Homo sapiens 4900 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210742 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210742&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440010 104087193 CHEMBL247371 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50382884 COc1cc(Cl)ccc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1 InChI=1S/C19H18Cl2N2O5S/c1-28-17-9-15(21)3-2-12(17)8-13-10-22-18(24)11-23(19(13)25)29(26,27)16-6-4-14(20)5-7-16/h2-7,9,13H,8,10-11H2,1H3,(H,22,24) GICOKTACZAOCME-UHFFFAOYSA-N 50210743 6-(4-chloro-2-methoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL391543 Chymase Homo sapiens 34 ChEMBL 10.1016/j.bmcl.2007.03.085 10.7270/Q2MK6CKH 17434735 Maruoka, H; Muto, T; Tanaka, T; Imajo, S; Tomimori, Y; Fukuda, Y; Nakatsuka, T 6/4/2007 11/10/2009 Daiichi Asubio Pharma http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210743 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210743&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 44440009 104087194 CHEMBL391543 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5