BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50381633	COc1ccc(cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1)C#N	InChI=1S/C20H18ClN3O5S/c1-29-18-7-2-13(10-22)8-14(18)9-15-11-23-19(25)12-24(20(15)26)30(27,28)17-5-3-16(21)4-6-17/h2-8,15H,9,11-12H2,1H3,(H,23,25)	MTJDNOXPBJRQFU-UHFFFAOYSA-N	50210094	3-((1-(4-chlorophenylsulfonyl)-3,7-dioxo-1,4-diazepan-6-yl)methyl)-4-methoxybenzonitrile::CHEMBL247168	Chymase	Homo sapiens		 27							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210094	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210094&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439969	104086710		CHEMBL247168					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381634	Clc1ccc(cc1)S(=O)(=O)N1CC(=O)NCC(Cc2ccncc2)C1=O	InChI=1S/C17H16ClN3O4S/c18-14-1-3-15(4-2-14)26(24,25)21-11-16(22)20-10-13(17(21)23)9-12-5-7-19-8-6-12/h1-8,13H,9-11H2,(H,20,22)	CMPTUTURPAZFGB-UHFFFAOYSA-N	50210095	4-(4-chlorophenylsulfonyl)-6-(pyridin-4-ylmethyl)-1,4-diazepane-2,5-dione::CHEMBL246758	Chymase	Homo sapiens		>10000							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210095	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210095&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439955	104086711		CHEMBL246758					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381635	CNC(=O)COc1ccc(Cl)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C21H21Cl2N3O6S/c1-24-20(28)12-32-18-7-4-16(23)9-13(18)8-14-10-25-19(27)11-26(21(14)29)33(30,31)17-5-2-15(22)3-6-17/h2-7,9,14H,8,10-12H2,1H3,(H,24,28)(H,25,27)	BIQKTCSWPQABMG-UHFFFAOYSA-N	50210096	2-(4-chloro-2-((1-(4-chlorophenylsulfonyl)-3,7-dioxo-1,4-diazepan-6-yl)methyl)phenoxy)-N-methylacetamide::CHEMBL396067	Chymase	Homo sapiens		 42							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210096	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210096&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439967	104086712		CHEMBL396067					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381636	Clc1ccc(cc1)S(=O)(=O)N1CC(=O)NCC(Cc2ccccc2Cl)C1=O	InChI=1S/C18H16Cl2N2O4S/c19-14-5-7-15(8-6-14)27(25,26)22-11-17(23)21-10-13(18(22)24)9-12-3-1-2-4-16(12)20/h1-8,13H,9-11H2,(H,21,23)	KCJXVNLFKHFBOG-UHFFFAOYSA-N	50210097	6-(2-chlorobenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL246961	Chymase	Homo sapiens		 110							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210097	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210097&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439958	104086713		CHEMBL246961					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381637	COc1cc(Cl)c(Cl)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C19H17Cl3N2O5S/c1-29-17-8-16(22)15(21)7-11(17)6-12-9-23-18(25)10-24(19(12)26)30(27,28)14-4-2-13(20)3-5-14/h2-5,7-8,12H,6,9-10H2,1H3,(H,23,25)	NYUDYXREZPBFKF-UHFFFAOYSA-N	50210098	6-(4,5-dichloro-2-methoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL428927	Chymase	Homo sapiens		 23							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210098	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210098&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439972	104086714		CHEMBL428927					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381638	OC(=O)COc1ccc(Cl)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C20H18Cl2N2O7S/c21-14-1-4-16(5-2-14)32(29,30)24-10-18(25)23-9-13(20(24)28)7-12-8-15(22)3-6-17(12)31-11-19(26)27/h1-6,8,13H,7,9-11H2,(H,23,25)(H,26,27)	MZKGVXPHEXNJSG-UHFFFAOYSA-N	50210099	rac-2q::CHEMBL246964	Chymase	Homo sapiens		 39							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210099	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210099&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439966	104086715		CHEMBL246964					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381639	COc1c(Cl)cc(F)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C19H17Cl2FN2O5S/c1-29-18-11(7-14(22)8-16(18)21)6-12-9-23-17(25)10-24(19(12)26)30(27,28)15-4-2-13(20)3-5-15/h2-5,7-8,12H,6,9-10H2,1H3,(H,23,25)	PNLZTVHNBZIXJW-UHFFFAOYSA-N	50210101	6-(3-chloro-5-fluoro-2-methoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL247583	Chymase	Homo sapiens		 4200							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210101	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210101&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439973	104086717		CHEMBL247583					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381640	Clc1ccc(cc1)S(=O)(=O)N1CC(=O)NCC(Cc2ccc3ccccc3c2)C1=O	InChI=1S/C22H19ClN2O4S/c23-19-7-9-20(10-8-19)30(28,29)25-14-21(26)24-13-18(22(25)27)12-15-5-6-16-3-1-2-4-17(16)11-15/h1-11,18H,12-14H2,(H,24,26)	GHXJYQHSECMOLE-UHFFFAOYSA-N	50210102	4-(4-chlorophenylsulfonyl)-6-(naphthalen-2-ylmethyl)-1,4-diazepane-2,5-dione::CHEMBL245738	Chymase	Homo sapiens		>10000							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210102	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210102&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439953	104086718		CHEMBL245738					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381641	COc1ccc(Cl)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C19H18Cl2N2O5S/c1-28-17-7-4-15(21)9-12(17)8-13-10-22-18(24)11-23(19(13)25)29(26,27)16-5-2-14(20)3-6-16/h2-7,9,13H,8,10-11H2,1H3,(H,22,24)	SOSJFTNPSZEBHV-UHFFFAOYSA-N	100740	CHEMBL391608::US8507714, 29	Chymase	Homo sapiens		 34							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=100740	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=100740&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			11626693	165223201		CHEMBL391608					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381642	COc1ccc(OC)c(CC2CNC(=O)CN(C2=O)S(=O)(=O)c2ccc(Cl)cc2)c1	InChI=1S/C20H21ClN2O6S/c1-28-16-5-8-18(29-2)13(10-16)9-14-11-22-19(24)12-23(20(14)25)30(26,27)17-6-3-15(21)4-7-17/h3-8,10,14H,9,11-12H2,1-2H3,(H,22,24)	DKXFJTJXXBENIH-UHFFFAOYSA-N	50210103	6-(2,5-dimethoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL247169	Chymase	Homo sapiens		 7400							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210103	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210103&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439971	104086719		CHEMBL247169					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381643	COc1ccc(Cl)cc1C[C@@H]1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C19H18Cl2N2O5S/c1-28-17-7-4-15(21)9-12(17)8-13-10-22-18(24)11-23(19(13)25)29(26,27)16-5-2-14(20)3-6-16/h2-7,9,13H,8,10-11H2,1H3,(H,22,24)	SOSJFTNPSZEBHV-UHFFFAOYSA-N	50210104	(R)-6-(5-chloro-2-methoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL395692	Chymase	Homo sapiens		>10000							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210104	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210104&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439975	104086720		CHEMBL395692					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381644	Clc1ccc(cc1)S(=O)(=O)N1CC(=O)NC\C(=C/c2ccccc2)C1=O	InChI=1S/C18H15ClN2O4S/c19-15-6-8-16(9-7-15)26(24,25)21-12-17(22)20-11-14(18(21)23)10-13-4-2-1-3-5-13/h1-10H,11-12H2,(H,20,22)	GPUMIZHVRFVHSD-UHFFFAOYSA-N	50210105	(E)-6-benzylidene-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL245542	Chymase	Homo sapiens		 1500							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210105	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210105&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439951	104086721		CHEMBL245542					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381645	Clc1ccc(CC2CNC(=O)CN(C2=O)S(=O)(=O)c2ccc(Cl)cc2)cc1	InChI=1S/C18H16Cl2N2O4S/c19-14-3-1-12(2-4-14)9-13-10-21-17(23)11-22(18(13)24)27(25,26)16-7-5-15(20)6-8-16/h1-8,13H,9-11H2,(H,21,23)	DEUXQEPGDAOCFW-UHFFFAOYSA-N	50210106	6-(4-chlorobenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL246960	Chymase	Homo sapiens		 460							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210106	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210106&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439956	104086722		CHEMBL246960					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381646	Clc1ccc(cc1)S(=O)(=O)n1c(=O)[nH]c2cc(Cl)ccc2c1=O	InChI=1S/C14H8Cl2N2O4S/c15-8-1-4-10(5-2-8)23(21,22)18-13(19)11-6-3-9(16)7-12(11)17-14(18)20/h1-7H,(H,17,20)	ZENSSHAETXPASI-UHFFFAOYSA-N	50210107	7-chloro-3-(4-chlorophenylsulfonyl)quinazoline-2,4(1H,3H)-dione::CHEMBL245539	Chymase	Homo sapiens		 18							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210107	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210107&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			17878496	104086723		CHEMBL245539					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381647	COc1ccc(O)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C19H19ClN2O6S/c1-28-17-7-4-15(23)9-12(17)8-13-10-21-18(24)11-22(19(13)25)29(26,27)16-5-2-14(20)3-6-16/h2-7,9,13,23H,8,10-11H2,1H3,(H,21,24)	JPSCCFDILCQWOD-UHFFFAOYSA-N	50210108	6-(5-hydroxy-2-methoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL398022	Chymase	Homo sapiens		 1100							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210108	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210108&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439970	104086724		CHEMBL398022					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381648	CCCOc1ccc(Cl)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C21H22Cl2N2O5S/c1-2-9-30-19-8-5-17(23)11-14(19)10-15-12-24-20(26)13-25(21(15)27)31(28,29)18-6-3-16(22)4-7-18/h3-8,11,15H,2,9-10,12-13H2,1H3,(H,24,26)	PQMWWCUSCSQSDA-UHFFFAOYSA-N	50210110	6-(5-chloro-2-propoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL246963	Chymase	Homo sapiens		 220							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210110	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210110&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439964	104086726		CHEMBL246963					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381649	CCOc1ccccc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C20H21ClN2O5S/c1-2-28-18-6-4-3-5-14(18)11-15-12-22-19(24)13-23(20(15)25)29(26,27)17-9-7-16(21)8-10-17/h3-10,15H,2,11-13H2,1H3,(H,22,24)	NMNYNMIWBXYVLJ-UHFFFAOYSA-N	50210109	6-(2-ethoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL246760	Chymase	Homo sapiens		 180							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210109	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210109&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439962	104086725		CHEMBL246760					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381650	CC(C)C[C@H](NC(=O)[C@@H](NC(=O)N[C@@H](Cc1ccccc1)C(O)=O)C1CCNC(N)=N1)C(=O)N[C@@H](Cc1ccccc1)C=O |c:30|	InChI=1S/C31H41N7O6/c1-19(2)15-24(27(40)34-22(18-39)16-20-9-5-3-6-10-20)35-28(41)26(23-13-14-33-30(32)36-23)38-31(44)37-25(29(42)43)17-21-11-7-4-8-12-21/h3-12,18-19,22-26H,13-17H2,1-2H3,(H,34,40)(H,35,41)(H,42,43)(H3,32,33,36)(H2,37,38,44)	MRXDGVXSWIXTQL-UHFFFAOYSA-N	87059	CHEMBL247767::Chymostatin	Chymase	Homo sapiens		 43							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=87059	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=87059&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			443119	136353108		CHEMBL247767					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381651	COc1ccccc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C19H19ClN2O5S/c1-27-17-5-3-2-4-13(17)10-14-11-21-18(23)12-22(19(14)24)28(25,26)16-8-6-15(20)7-9-16/h2-9,14H,10-12H2,1H3,(H,21,23)	QXQPPKKMLGBJRR-UHFFFAOYSA-N	50210115	6-(2-methoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL246962	Chymase	Homo sapiens		 140							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210115	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210115&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439961	104086731		CHEMBL246962					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381652	Clc1ccc(cc1)S(=O)(=O)N1CC(=O)NCC(CC2CCCCC2)C1=O	InChI=1S/C18H23ClN2O4S/c19-15-6-8-16(9-7-15)26(24,25)21-12-17(22)20-11-14(18(21)23)10-13-4-2-1-3-5-13/h6-9,13-14H,1-5,10-12H2,(H,20,22)	LOUIINLOMUCLNF-UHFFFAOYSA-N	50210111	4-(4-chlorophenylsulfonyl)-6-(cyclohexylmethyl)-1,4-diazepane-2,5-dione::CHEMBL396167	Chymase	Homo sapiens		>10000							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210111	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210111&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439952	104086727		CHEMBL396167					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381653	CCOc1ccc(Cl)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C20H20Cl2N2O5S/c1-2-29-18-8-5-16(22)10-13(18)9-14-11-23-19(25)12-24(20(14)26)30(27,28)17-6-3-15(21)4-7-17/h3-8,10,14H,2,9,11-12H2,1H3,(H,23,25)	HFXKQPFMHYFUNF-UHFFFAOYSA-N	50210113	6-(5-chloro-2-ethoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL246762	Chymase	Homo sapiens		 83							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210113	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210113&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439963	104086729		CHEMBL246762					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381654	Clc1ccc(cc1)S(=O)(=O)N1CC(=O)NCC(Cc2ccccc2)C1=O	InChI=1S/C18H17ClN2O4S/c19-15-6-8-16(9-7-15)26(24,25)21-12-17(22)20-11-14(18(21)23)10-13-4-2-1-3-5-13/h1-9,14H,10-12H2,(H,20,22)	DWOHVFRTCUWUFA-UHFFFAOYSA-N	50210117	6-benzyl-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL245541	Chymase	Homo sapiens		 420							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210117	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210117&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439950	104086733		CHEMBL245541					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381655	CCCCOc1ccc(Cl)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C22H24Cl2N2O5S/c1-2-3-10-31-20-9-6-18(24)12-15(20)11-16-13-25-21(27)14-26(22(16)28)32(29,30)19-7-4-17(23)5-8-19/h4-9,12,16H,2-3,10-11,13-14H2,1H3,(H,25,27)	YEGMMGVEFHOTOW-UHFFFAOYSA-N	50210114	6-(2-butoxy-5-chlorobenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL395822	Chymase	Homo sapiens		 280							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210114	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210114&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439965	104086730		CHEMBL395822					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381656	COc1ccc(F)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C19H18ClFN2O5S/c1-28-17-7-4-15(21)9-12(17)8-13-10-22-18(24)11-23(19(13)25)29(26,27)16-5-2-14(20)3-6-16/h2-7,9,13H,8,10-11H2,1H3,(H,22,24)	FXSNNJFHADWQPZ-UHFFFAOYSA-N	50210116	6-(5-fluoro-2-methoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL246965	Chymase	Homo sapiens		 26							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210116	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210116&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439968	104086732		CHEMBL246965					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381657	Clc1ccc(cc1)S(=O)(=O)N1CC(=O)NCC(Cc2cccnc2)C1=O	InChI=1S/C17H16ClN3O4S/c18-14-3-5-15(6-4-14)26(24,25)21-11-16(22)20-10-13(17(21)23)8-12-2-1-7-19-9-12/h1-7,9,13H,8,10-11H2,(H,20,22)	QBAPAIGRPDIDJK-UHFFFAOYSA-N	50210119	4-(4-chlorophenylsulfonyl)-6-(pyridin-3-ylmethyl)-1,4-diazepane-2,5-dione::CHEMBL245739	Chymase	Homo sapiens		>10000							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210119	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210119&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439954	104086735		CHEMBL245739					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381658	COc1ccc(Cl)cc1C[C@H]1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C19H18Cl2N2O5S/c1-28-17-7-4-15(21)9-12(17)8-13-10-22-18(24)11-23(19(13)25)29(26,27)16-5-2-14(20)3-6-16/h2-7,9,13H,8,10-11H2,1H3,(H,22,24)	SOSJFTNPSZEBHV-UHFFFAOYSA-N	50210120	(S)-6-(5-chloro-2-methoxybenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL247185	Chymase	Homo sapiens		 27							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210120	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210120&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439974	104086736		CHEMBL247185					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381659	COc1ccc(Cl)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C19H18Cl2N2O5S/c1-28-17-7-4-15(21)9-12(17)8-13-10-22-18(24)11-23(19(13)25)29(26,27)16-5-2-14(20)3-6-16/h2-7,9,13H,8,10-11H2,1H3,(H,22,24)	SOSJFTNPSZEBHV-UHFFFAOYSA-N	100740	CHEMBL391608::US8507714, 29	Neutrophil elastase	Homo sapiens		>10000							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=100740	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5023&target=Neutrophil+elastase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=100740&enzyme=Neutrophil+elastase&column=ki&startPg=0&Increment=50&submit=Search			11626693	165223201		CHEMBL391608					1	MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH	7WHU,7CBK,9SI4,9ATU,9ATK,9ASX,9ASS,8VK5,8QGX,8G26,8G25,8G24,8D7K,8D7I,8D4U,8D4Q,6SMA,6F5M,6E69,5ABW,5A8Z,5A8Y,5A8X,5A0C,5A0B,5A0A,5A09,4WVP,4NZL,3Q77,3Q76,2Z7F,2RG3,1PPG,1PPF,1H1B	Neutrophil elastase	ELNE_HUMAN	P08246	P09649 Q6B0D9 Q6LDP5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381660	COc1ccc(Cl)cc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C19H18Cl2N2O5S/c1-28-17-7-4-15(21)9-12(17)8-13-10-22-18(24)11-23(19(13)25)29(26,27)16-5-2-14(20)3-6-16/h2-7,9,13H,8,10-11H2,1H3,(H,22,24)	SOSJFTNPSZEBHV-UHFFFAOYSA-N	100740	CHEMBL391608::US8507714, 29	Cathepsin G	Homo sapiens		 2900							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=100740	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=100740&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search			11626693	165223201		CHEMBL391608					1	MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL	7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S	Cathepsin G	CATG_HUMAN	P08311	Q6IBJ6 Q9UCA5 Q9UCU6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381661	Clc1ccc(cc1)S(=O)(=O)N1CC(=O)NCC(Cc2cccc(Cl)c2)C1=O	InChI=1S/C18H16Cl2N2O4S/c19-14-4-6-16(7-5-14)27(25,26)22-11-17(23)21-10-13(18(22)24)8-12-2-1-3-15(20)9-12/h1-7,9,13H,8,10-11H2,(H,21,23)	SVAUXVFRMUNISS-UHFFFAOYSA-N	50210118	6-(3-chlorobenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL395683	Chymase	Homo sapiens		 310							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210118	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210118&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439957	104086734		CHEMBL395683					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50381662	Fc1ccccc1CC1CNC(=O)CN(C1=O)S(=O)(=O)c1ccc(Cl)cc1	InChI=1S/C18H16ClFN2O4S/c19-14-5-7-15(8-6-14)27(25,26)22-11-17(23)21-10-13(18(22)24)9-12-3-1-2-4-16(12)20/h1-8,13H,9-11H2,(H,21,23)	JCACJGGQMJFBLS-UHFFFAOYSA-N	50210121	6-(2-fluorobenzyl)-4-(4-chlorophenylsulfonyl)-1,4-diazepane-2,5-dione::CHEMBL395684	Chymase	Homo sapiens		 150							ChEMBL	10.1016/j.bmcl.2007.03.038	10.7270/Q2G160H9	17419055			Tanaka, T; Muto, T; Maruoka, H; Imajo, S; Fukami, H; Tomimori, Y; Fukuda, Y; Nakatsuka, T	6/4/2007	11/10/2009	Daiichi Asubio Pharma	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50210121	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50210121&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search			44439959	104086737		CHEMBL395684					1	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN	1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ	Chymase	CMA1_HUMAN	P23946	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
