BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50365870	OC(=O)c1ccc2cc(ccc2c1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1	InChI=1S/C23H13ClN2O3S/c24-17-6-3-13(4-7-17)20-11-19-21(30-20)22(27)26(12-25-19)18-8-5-14-9-16(23(28)29)2-1-15(14)10-18/h1-12H,(H,28,29)	OPXZJSGFUFISKN-UHFFFAOYSA-N	50199243	6-[6-(4-chlorophenyl)-4-oxothieno[3,2-d]pyrimidin-3(4H)-yl]-2-naphthalenecarboxylic acid::CHEMBL410641	Melanin-concentrating hormone receptor 1	Homo sapiens		>10000							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199243	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199243&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994909	104079899		CHEMBL410641					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365871	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4ccccc4c3)c(=O)c2s1	InChI=1S/C22H13ClN2OS/c23-17-8-5-15(6-9-17)20-12-19-21(27-20)22(26)25(13-24-19)18-10-7-14-3-1-2-4-16(14)11-18/h1-13H	XZNKOHFXNRRBKF-UHFFFAOYSA-N	50199244	6-(4-chlorophenyl)-3-(2-naphthalenyl)thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL217550	Melanin-concentrating hormone receptor 1	Homo sapiens		>10000							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199244	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199244&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994273	104079900		CHEMBL217550					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365872	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4cc(ccc4c3)C(=O)N3CCCC3)c(=O)c2s1	InChI=1S/C27H20ClN3O2S/c28-21-8-5-17(6-9-21)24-15-23-25(34-24)27(33)31(16-29-23)22-10-7-18-13-20(4-3-19(18)14-22)26(32)30-11-1-2-12-30/h3-10,13-16H,1-2,11-12H2	GZTRTESDPOCGER-UHFFFAOYSA-N	50199245	6-(4-chlorophenyl)-3-[6-(1-pyrrolidinylcarbonyl)-2-naphthalenyl]thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL216950	Melanin-concentrating hormone receptor 1	Homo sapiens		>10000							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199245	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199245&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994276	104079901		CHEMBL216950					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365873	COC[C@H]1CCCN1Cc1cc2cc(ccc2o1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1	InChI=1S/C27H24ClN3O3S/c1-33-15-21-3-2-10-30(21)14-22-12-18-11-20(8-9-24(18)34-22)31-16-29-23-13-25(35-26(23)27(31)32)17-4-6-19(28)7-5-17/h4-9,11-13,16,21H,2-3,10,14-15H2,1H3	MTAKKFFTZMEHRX-UHFFFAOYSA-N	50199246	3-(2-{[(2R)-2-(methoxymethyl)pyrrolidin-1-yl]methyl}-1-benzofuran-5-yl)-6-(4-methylphenyl)thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL384147	Melanin-concentrating hormone receptor 1	Homo sapiens		 9.5							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199246	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199246&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11995028	104079902		CHEMBL384147					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365874	CN1CCN(Cc2cc3cc(ccc3s2)-n2cnc3cc(sc3c2=O)-c2ccc(Cl)cc2)CC1	InChI=1S/C26H23ClN4OS2/c1-29-8-10-30(11-9-29)15-21-13-18-12-20(6-7-23(18)33-21)31-16-28-22-14-24(34-25(22)26(31)32)17-2-4-19(27)5-3-17/h2-7,12-14,16H,8-11,15H2,1H3	XYCZXPVVNCEPEF-UHFFFAOYSA-N	50199247	6-(4-chlorophenyl)-3-{2-[(4-methylpiperazin-1-yl)methyl]-1-benzothien-5-yl}thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL412135	Melanin-concentrating hormone receptor 1	Homo sapiens		 9.7							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199247	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199247&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11547939	104079903		CHEMBL412135					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365875	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4oc(CN5CCCC5)cc4c3)c(=O)c2s1	InChI=1S/C25H20ClN3O2S/c26-18-5-3-16(4-6-18)23-13-21-24(32-23)25(30)29(15-27-21)19-7-8-22-17(11-19)12-20(31-22)14-28-9-1-2-10-28/h3-8,11-13,15H,1-2,9-10,14H2	HJZNQSRZSUDTDL-UHFFFAOYSA-N	50199248	6-(4-methylphenyl)-3-[2-(pyrrolidin-1-ylmethyl)-1-benzofuran-5-yl]thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL217178	Melanin-concentrating hormone receptor 1	Homo sapiens		 1.1							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199248	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199248&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994784	104079904		CHEMBL217178					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365876	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4C=C(CN5CCCC5)CCc4c3)c(=O)c2s1 |t:18|	InChI=1S/C27H24ClN3OS/c28-22-8-5-19(6-9-22)25-15-24-26(33-25)27(32)31(17-29-24)23-10-7-20-13-18(3-4-21(20)14-23)16-30-11-1-2-12-30/h5-10,13-15,17H,1-4,11-12,16H2	WUAXCPYYHBPYFR-UHFFFAOYSA-N	50199249	6-(4-chlorophenyl)-3-[6-(1-pyrrolidinylmethyl)-7,8-dihydro-2-naphthalenyl]thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL385690	Melanin-concentrating hormone receptor 1	Homo sapiens		 0.87							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199249	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199249&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994412	104079905		CHEMBL385690					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365877	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4C=C(CN5CCCCC5)CCc4c3)c(=O)c2s1 |t:18|	InChI=1S/C28H26ClN3OS/c29-23-9-6-20(7-10-23)26-16-25-27(34-26)28(33)32(18-30-25)24-11-8-21-14-19(4-5-22(21)15-24)17-31-12-2-1-3-13-31/h6-11,14-16,18H,1-5,12-13,17H2	DMADJAYTJYCDGS-UHFFFAOYSA-N	50199251	6-(4-chlorophenyl)-3-[6-(1-piperidinylmethyl)-7,8-dihydro-2-naphthalenyl]thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL218077	Melanin-concentrating hormone receptor 1	Homo sapiens		 0.75							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199251	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199251&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994912	104079907		CHEMBL218077					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365878	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4cc(ccc4c3)C(=O)NCCCN3CCCC3)c(=O)c2s1	InChI=1S/C30H27ClN4O2S/c31-24-9-6-20(7-10-24)27-18-26-28(38-27)30(37)35(19-33-26)25-11-8-21-16-23(5-4-22(21)17-25)29(36)32-12-3-15-34-13-1-2-14-34/h4-11,16-19H,1-3,12-15H2,(H,32,36)	KTUUGIXLHKSABH-UHFFFAOYSA-N	50199250	6-[6-(4-chlorophenyl)-4-oxothieno[3,2-d]pyrimidin-3(4H)-yl]-N-[3-(1-pyrrolidinyl)propyl]-2-naphthalenecarboxamide::CHEMBL214571	Melanin-concentrating hormone receptor 1	Homo sapiens		 1412							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199250	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199250&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994910	104079906		CHEMBL214571					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365879	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4sc(CN5CCCCC5)cc4c3)c(=O)c2s1	InChI=1S/C26H22ClN3OS2/c27-19-6-4-17(5-7-19)24-14-22-25(33-24)26(31)30(16-28-22)20-8-9-23-18(12-20)13-21(32-23)15-29-10-2-1-3-11-29/h4-9,12-14,16H,1-3,10-11,15H2	PVFOJNGXRJKDMG-UHFFFAOYSA-N	50199252	6-(4-chlorophenyl)-3-[2-(piperidin-1-ylmethyl)-1-benzothien-5-yl]thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL437914	Melanin-concentrating hormone receptor 1	Homo sapiens		 2							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199252	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199252&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11995025	104079908		CHEMBL437914					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365880	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4CC(CN5CCCC5)CCc4c3)c(=O)c2s1	InChI=1S/C27H26ClN3OS/c28-22-8-5-19(6-9-22)25-15-24-26(33-25)27(32)31(17-29-24)23-10-7-20-13-18(3-4-21(20)14-23)16-30-11-1-2-12-30/h5-10,14-15,17-18H,1-4,11-13,16H2	LCFDTYGDUUJULJ-UHFFFAOYSA-N	50199253	6-(4-chlorophenyl)-3-[6-(1-pyrrolidinylmethyl)-5,6,7,8-tetrahydro-2-naphthalenyl]thieno[3,2-d]pyrimidin-4-(3H)-one::CHEMBL214871	Melanin-concentrating hormone receptor 1	Homo sapiens		 1.3							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199253	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199253&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994913	104079909		CHEMBL214871					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365881	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4sc(CN5CCCC5)cc4c3)c(=O)c2s1	InChI=1S/C25H20ClN3OS2/c26-18-5-3-16(4-6-18)23-13-21-24(32-23)25(30)29(15-27-21)19-7-8-22-17(11-19)12-20(31-22)14-28-9-1-2-10-28/h3-8,11-13,15H,1-2,9-10,14H2	YUEOOJLKOJXWIA-UHFFFAOYSA-N	50199254	6-(4-chlorophenyl)-3-[2-(1-pyrrolidinylmethyl)-1-benzothien-5-yl]thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL384133	Melanin-concentrating hormone receptor 1	Homo sapiens		 0.91							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199254	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199254&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11995024	104079910		CHEMBL384133					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365882	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4sc(CN5CCC(CC5)c5ccccc5)cc4c3)c(=O)c2s1	InChI=1S/C32H26ClN3OS2/c33-25-8-6-23(7-9-25)30-18-28-31(39-30)32(37)36(20-34-28)26-10-11-29-24(16-26)17-27(38-29)19-35-14-12-22(13-15-35)21-4-2-1-3-5-21/h1-11,16-18,20,22H,12-15,19H2	NRMDDYSFIYWXTP-UHFFFAOYSA-N	50199255	6-(4-chlorophenyl)-3-{2-[(4-phenylpiperidin-1-yl)methyl]-1-benzothien-5-yl}thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL217410	Melanin-concentrating hormone receptor 1	Homo sapiens		 5.7							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199255	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199255&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994661	104079911		CHEMBL217410					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365883	CN(C)CC1CCc2cc(ccc2C1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1	InChI=1S/C25H24ClN3OS/c1-28(2)14-16-3-4-19-12-21(10-7-18(19)11-16)29-15-27-22-13-23(31-24(22)25(29)30)17-5-8-20(26)9-6-17/h5-10,12-13,15-16H,3-4,11,14H2,1-2H3	MLELJHRGOKUEGH-UHFFFAOYSA-N	50199256	6-(4-chlorophenyl)-3-{6-[(dimethylamino)methyl]-5,6,7,8-tetrahydro-2-naphthalenyl}thieno[3,2-d]pyrimidin-4-(3H)-one::CHEMBL214806	Melanin-concentrating hormone receptor 1	Homo sapiens		 1.1							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199256	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199256&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994413	104079912		CHEMBL214806					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365884	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4CC(CN5CCCCC5)CCc4c3)c(=O)c2s1	InChI=1S/C28H28ClN3OS/c29-23-9-6-20(7-10-23)26-16-25-27(34-26)28(33)32(18-30-25)24-11-8-21-14-19(4-5-22(21)15-24)17-31-12-2-1-3-13-31/h6-11,15-16,18-19H,1-5,12-14,17H2	ZHPSMWWFXSXWBZ-UHFFFAOYSA-N	50199257	6-(4-chlorophenyl)-3-[6-(1-piperidinylmethyl)-5,6,7,8-tetrahydro-2-naphthalenyl]thieno[3,2-d]pyrimidin-4-(3H)-one::CHEMBL214181	Melanin-concentrating hormone receptor 1	Homo sapiens		 3.1							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199257	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199257&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994414	104079913		CHEMBL214181					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365885	O[C@@H]1CCN(Cc2cc3cc(ccc3s2)-n2cnc3cc(sc3c2=O)-c2ccc(Cl)cc2)C1	InChI=1S/C25H20ClN3O2S2/c26-17-3-1-15(2-4-17)23-11-21-24(33-23)25(31)29(14-27-21)18-5-6-22-16(9-18)10-20(32-22)13-28-8-7-19(30)12-28/h1-6,9-11,14,19,30H,7-8,12-13H2	ZDFHQJRHOKOKEF-UHFFFAOYSA-N	50199261	6-(4-chlorophenyl)-3-(2-{[(3R)-3-hydroxypyrrolidin-1-yl]-methyl}-1-benzothien-5-yl)thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL262945	Melanin-concentrating hormone receptor 1	Homo sapiens		 2.5							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199261	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199261&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994660	104079917		CHEMBL262945					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365886	CN(C)CC1=Cc2ccc(cc2CC1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 |t:4|	InChI=1S/C25H22ClN3OS/c1-28(2)14-16-3-4-19-12-21(10-7-18(19)11-16)29-15-27-22-13-23(31-24(22)25(29)30)17-5-8-20(26)9-6-17/h5-13,15H,3-4,14H2,1-2H3	PBLFIAGNVFEMPX-UHFFFAOYSA-N	50199262	6-(4-chlorophenyl)-3-{6-[(dimethylamino)methyl]-7,8-dihydro-2-naphthalenyl}thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL387419	Melanin-concentrating hormone receptor 1	Homo sapiens		 2.7							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199262	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199262&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994911	104079918		CHEMBL387419					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365887	Cn1c(CN2CCCC2)cc2cc(ccc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1	InChI=1S/C26H23ClN4OS/c1-29-21(15-30-10-2-3-11-30)13-18-12-20(8-9-23(18)29)31-16-28-22-14-24(33-25(22)26(31)32)17-4-6-19(27)7-5-17/h4-9,12-14,16H,2-3,10-11,15H2,1H3	MIYQNLFTRRTMNL-UHFFFAOYSA-N	50199258	6-(4-chlorophenyl)-3-[1-methyl-2-(pyrrolidin-1-ylmethyl)-1Hindol-5-yl]thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL217887	Melanin-concentrating hormone receptor 1	Homo sapiens		 1.1							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199258	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199258&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994786	104079914		CHEMBL217887					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365888	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4sc(CN5CCN(CC5)c5ccccc5)cc4c3)c(=O)c2s1	InChI=1S/C31H25ClN4OS2/c32-23-8-6-21(7-9-23)29-18-27-30(39-29)31(37)36(20-33-27)25-10-11-28-22(16-25)17-26(38-28)19-34-12-14-35(15-13-34)24-4-2-1-3-5-24/h1-11,16-18,20H,12-15,19H2	QOIDPHCDTNXCDA-UHFFFAOYSA-N	50199259	6-(4-chlorophenyl)-3-{2-[(4-phenylpiperazin-1-yl)methyl]-1-benzothien-5-yl}thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL384553	Melanin-concentrating hormone receptor 1	Homo sapiens		 29							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199259	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199259&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994662	104079915		CHEMBL384553					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365889	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4cc(ccc4c3)C(=O)NCCN3CCCC3)c(=O)c2s1	InChI=1S/C29H25ClN4O2S/c30-23-8-5-19(6-9-23)26-17-25-27(37-26)29(36)34(18-32-25)24-10-7-20-15-22(4-3-21(20)16-24)28(35)31-11-14-33-12-1-2-13-33/h3-10,15-18H,1-2,11-14H2,(H,31,35)	CVMUMFKQGWSATO-UHFFFAOYSA-N	50199263	6-[6-(4-chlorophenyl)-4-oxothieno[3,2-d]pyrimidin-3(4H)-yl]-N-[2-(1-pyrrolidinyl)ethyl]-2-naphthalenecarboxamide::CHEMBL216356	Melanin-concentrating hormone receptor 1	Homo sapiens		 5							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199263	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199263&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994277	104079919		CHEMBL216356					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365890	CN(C)Cc1cc2cc(ccc2s1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1	InChI=1S/C23H18ClN3OS2/c1-26(2)12-18-10-15-9-17(7-8-20(15)29-18)27-13-25-19-11-21(30-22(19)23(27)28)14-3-5-16(24)6-4-14/h3-11,13H,12H2,1-2H3	XJMIODNDCXPYKT-UHFFFAOYSA-N	50199260	6-(4-chlorophenyl)-3-{2-[(dimethylamino)methyl]-1-benzothien-5-yl}thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL216117	Melanin-concentrating hormone receptor 1	Homo sapiens		 1.3							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199260	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199260&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994659	104079916		CHEMBL216117					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365891	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4sc(CN5CCOCC5)cc4c3)c(=O)c2s1	InChI=1S/C25H20ClN3O2S2/c26-18-3-1-16(2-4-18)23-13-21-24(33-23)25(30)29(15-27-21)19-5-6-22-17(11-19)12-20(32-22)14-28-7-9-31-10-8-28/h1-6,11-13,15H,7-10,14H2	QUPILHSZFLDDLG-UHFFFAOYSA-N	50199264	6-(4-chlorophenyl)-3-[2-(morpholin-4-ylmethyl)-1-benzothien-5-yl]thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL386900	Melanin-concentrating hormone receptor 1	Homo sapiens		 38							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199264	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199264&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11995026	104079920		CHEMBL386900					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365892	COC[C@H]1CCCN1Cc1cc2cc(ccc2n1C)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1	InChI=1S/C28H27ClN4O2S/c1-31-23(15-32-11-3-4-22(32)16-35-2)13-19-12-21(9-10-25(19)31)33-17-30-24-14-26(36-27(24)28(33)34)18-5-7-20(29)8-6-18/h5-10,12-14,17,22H,3-4,11,15-16H2,1-2H3	JNHZMEBIKUJAIN-UHFFFAOYSA-N	50199265	6-(4-chlorophenyl)-3-(2-{[(2R)-2-(methoxymethyl)pyrrolidin-1-yl]methyl}-1-methyl-1H-indol-5-yl)thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL217733	Melanin-concentrating hormone receptor 1	Homo sapiens		 1.4							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199265	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199265&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994780	104079921		CHEMBL217733					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365893	OCc1ccc2cc(ccc2c1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1	InChI=1S/C23H15ClN2O2S/c24-18-6-3-15(4-7-18)21-11-20-22(29-21)23(28)26(13-25-20)19-8-5-16-9-14(12-27)1-2-17(16)10-19/h1-11,13,27H,12H2	LGQRXFXMSKWBCD-UHFFFAOYSA-N	50199267	6-(4-chlorophenyl)-3-[6-(hydroxymethyl)-2-naphthalenyl]thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL217356	Melanin-concentrating hormone receptor 1	Homo sapiens		 32							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199267	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199267&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994275	104079923		CHEMBL217356					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50365894	Clc1ccc(cc1)-c1cc2ncn(-c3ccc4cc(CN5CCCCC5)ccc4c3)c(=O)c2s1	InChI=1S/C28H24ClN3OS/c29-23-9-6-20(7-10-23)26-16-25-27(34-26)28(33)32(18-30-25)24-11-8-21-14-19(4-5-22(21)15-24)17-31-12-2-1-3-13-31/h4-11,14-16,18H,1-3,12-13,17H2	FJPBPFUKHDZYIJ-UHFFFAOYSA-N	50199266	6-(4-chlorophenyl)-3-[6-(1-piperidinylmethyl)-2-naphthalenyl]thieno[3,2-d]pyrimidin-4(3H)-one::CHEMBL214523	Melanin-concentrating hormone receptor 1	Homo sapiens		 0.39							ChEMBL	10.1021/jm060814b	10.7270/Q2JD4WFT	17125263			Tavares, FX; Al-Barazanji, KA; Bishop, MJ; Britt, CS; Carlton, DL; Cooper, JP; Feldman, PL; Garrido, DM; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Lang, DG; McIntyre, MS; Ott, RJ; Peat, AJ; Zhou, HQ	11/27/2006	11/10/2009	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199266	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199266&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11994411	104079922		CHEMBL214523					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
