BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51034223 CCCn1c(nc2cc(ccc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1)N(C)C InChI=1S/C24H22ClN5OS/c1-4-11-29-20-10-9-17(12-18(20)27-24(29)28(2)3)30-14-26-19-13-21(32-22(19)23(30)31)15-5-7-16(25)8-6-15/h5-10,12-14H,4,11H2,1-3H3 RQKILWARSODQOL-UHFFFAOYSA-N 50422886 CHEMBL385410 Melanin-concentrating hormone receptor 1 Homo sapiens 5.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422886 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422886&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416935 164151761 CHEMBL385410 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034224 Clc1ccc(cc1)-c1cc2ncn(-c3ccc4nc([nH]c4c3)N3CCCC3)c(=O)c2s1 InChI=1S/C23H18ClN5OS/c24-15-5-3-14(4-6-15)20-12-19-21(31-20)22(30)29(13-25-19)16-7-8-17-18(11-16)27-23(26-17)28-9-1-2-10-28/h3-8,11-13H,1-2,9-10H2,(H,26,27) XZVGIPQQAGNDJX-UHFFFAOYSA-N 50422887 CHEMBL215868 Melanin-concentrating hormone receptor 1 Homo sapiens 3.2 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422887 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422887&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417044 164151762 CHEMBL215868 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034225 Cn1c(nc2ccc(cc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1)N1CCCC1 InChI=1S/C24H20ClN5OS/c1-28-20-12-17(8-9-18(20)27-24(28)29-10-2-3-11-29)30-14-26-19-13-21(32-22(19)23(30)31)15-4-6-16(25)7-5-15/h4-9,12-14H,2-3,10-11H2,1H3 HZSQILVFLHRBJH-UHFFFAOYSA-N 50422888 CHEMBL214824 Melanin-concentrating hormone receptor 1 Homo sapiens 6.3 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422888 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422888&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416845 164151763 CHEMBL214824 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034226 COCCNc1nc2ccc(cc2[nH]1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C22H18ClN5O2S/c1-30-9-8-24-22-26-16-7-6-15(10-17(16)27-22)28-12-25-18-11-19(31-20(18)21(28)29)13-2-4-14(23)5-3-13/h2-7,10-12H,8-9H2,1H3,(H2,24,26,27) LZWYOBQGPUJFQP-UHFFFAOYSA-N 50422889 CHEMBL213864 Melanin-concentrating hormone receptor 1 Homo sapiens 32 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422889 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422889&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417140 164151764 CHEMBL213864 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034227 Cc1nc2cc(ccc2n1CCCO)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C23H19ClN4O2S/c1-14-26-18-11-17(7-8-20(18)27(14)9-2-10-29)28-13-25-19-12-21(31-22(19)23(28)30)15-3-5-16(24)6-4-15/h3-8,11-13,29H,2,9-10H2,1H3 UIVSQWLEEUYWIU-UHFFFAOYSA-N 50422890 CHEMBL213813 Melanin-concentrating hormone receptor 1 Homo sapiens 1.6 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422890 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422890&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416857 164151765 CHEMBL213813 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034228 Cc1nc2cc(ccc2n1-c1ccc(C)cc1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C27H19ClN4OS/c1-16-3-9-20(10-4-16)32-17(2)30-22-13-21(11-12-24(22)32)31-15-29-23-14-25(34-26(23)27(31)33)18-5-7-19(28)8-6-18/h3-15H,1-2H3 YZZHYSIHUSTHFU-UHFFFAOYSA-N 50422891 CHEMBL214733 Melanin-concentrating hormone receptor 1 Homo sapiens 20 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422891 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422891&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416871 164151766 CHEMBL214733 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034229 CN(C)c1ccc(cc1)-n1c(C)nc2cc(ccc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C28H22ClN5OS/c1-17-31-23-14-22(12-13-25(23)34(17)21-10-8-20(9-11-21)32(2)3)33-16-30-24-15-26(36-27(24)28(33)35)18-4-6-19(29)7-5-18/h4-16H,1-3H3 IIXPVVPLTZJXSU-UHFFFAOYSA-N 50422892 CHEMBL214908 Melanin-concentrating hormone receptor 1 Homo sapiens 5.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422892&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416777 164151767 CHEMBL214908 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034230 Cc1nc2cc(ccc2n1CCN1CCCC1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C26H24ClN5OS/c1-17-29-21-14-20(8-9-23(21)31(17)13-12-30-10-2-3-11-30)32-16-28-22-15-24(34-25(22)26(32)33)18-4-6-19(27)7-5-18/h4-9,14-16H,2-3,10-13H2,1H3 GILGAAMNDOIHJG-UHFFFAOYSA-N 50422893 CHEMBL384724 Melanin-concentrating hormone receptor 1 Homo sapiens 2.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422893 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422893&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416837 164151768 CHEMBL384724 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034231 Cc1nc2cc(ccc2n1C1CCCCC1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C26H23ClN4OS/c1-16-29-21-13-20(11-12-23(21)31(16)19-5-3-2-4-6-19)30-15-28-22-14-24(33-25(22)26(30)32)17-7-9-18(27)10-8-17/h7-15,19H,2-6H2,1H3 QCAMZYGRBLGCMY-UHFFFAOYSA-N 50422894 CHEMBL215234 Melanin-concentrating hormone receptor 1 Homo sapiens 6.3 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422894 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422894&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416814 164151769 CHEMBL215234 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034232 COc1ccc(cc1)-n1c(nc2cc(ccc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1)N(C)C InChI=1S/C28H22ClN5O2S/c1-32(2)28-31-22-14-20(10-13-24(22)34(28)19-8-11-21(36-3)12-9-19)33-16-30-23-15-25(37-26(23)27(33)35)17-4-6-18(29)7-5-17/h4-16H,1-3H3 NNZNBACALDNMRJ-UHFFFAOYSA-N 50422895 CHEMBL213766 Melanin-concentrating hormone receptor 1 Homo sapiens 10.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422895 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422895&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417150 164151770 CHEMBL213766 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034233 CCOc1ccc(cc1)-n1c(C)nc2cc(ccc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C28H21ClN4O2S/c1-3-35-22-11-8-20(9-12-22)33-17(2)31-23-14-21(10-13-25(23)33)32-16-30-24-15-26(36-27(24)28(32)34)18-4-6-19(29)7-5-18/h4-16H,3H2,1-2H3 IUOQIICLQXRPBG-UHFFFAOYSA-N 50422896 CHEMBL214705 Melanin-concentrating hormone receptor 1 Homo sapiens 3.2 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422896 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422896&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416890 164151771 CHEMBL214705 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034234 CN1CCN(CC1)c1nc2ccc(cc2[nH]1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C24H21ClN6OS/c1-29-8-10-30(11-9-29)24-27-18-7-6-17(12-19(18)28-24)31-14-26-20-13-21(33-22(20)23(31)32)15-2-4-16(25)5-3-15/h2-7,12-14H,8-11H2,1H3,(H,27,28) RHHYVOUXHADFMO-UHFFFAOYSA-N 50422897 CHEMBL216649 Melanin-concentrating hormone receptor 1 Homo sapiens 100 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422897 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422897&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416751 164151772 CHEMBL216649 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034235 COc1ccc(Cn2c(nc3cc(ccc23)-n2cnc3cc(sc3c2=O)-c2ccc(Cl)cc2)N(C)C)cc1 InChI=1S/C29H24ClN5O2S/c1-33(2)29-32-23-14-21(10-13-25(23)34(29)16-18-4-11-22(37-3)12-5-18)35-17-31-24-15-26(38-27(24)28(35)36)19-6-8-20(30)9-7-19/h4-15,17H,16H2,1-3H3 IZGQPQGDFZGRAJ-UHFFFAOYSA-N 50422898 CHEMBL213824 Melanin-concentrating hormone receptor 1 Homo sapiens 13 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422898 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422898&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416956 164151773 CHEMBL213824 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034236 CN(C)c1nc2ccc(cc2n1CCO)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C23H20ClN5O2S/c1-27(2)23-26-17-8-7-16(11-19(17)28(23)9-10-30)29-13-25-18-12-20(32-21(18)22(29)31)14-3-5-15(24)6-4-14/h3-8,11-13,30H,9-10H2,1-2H3 RJZWWGQFGCBYKV-UHFFFAOYSA-N 50422899 CHEMBL218186 Melanin-concentrating hormone receptor 1 Homo sapiens 13 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422899 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422899&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416995 164151774 CHEMBL218186 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034237 COc1ccc(cc1)-n1c(C)nc2cc(ccc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C27H19ClN4O2S/c1-16-30-22-13-20(9-12-24(22)32(16)19-7-10-21(34-2)11-8-19)31-15-29-23-14-25(35-26(23)27(31)33)17-3-5-18(28)6-4-17/h3-15H,1-2H3 LCGCBEWDLYYVRE-UHFFFAOYSA-N 50422900 CHEMBL215008 Melanin-concentrating hormone receptor 1 Homo sapiens 5.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422900 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422900&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416872 164151775 CHEMBL215008 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034238 Clc1ccc(cc1)-c1cc2ncn(-c3ccc4nc(NCCN5CCCC5)[nH]c4c3)c(=O)c2s1 InChI=1S/C25H23ClN6OS/c26-17-5-3-16(4-6-17)22-14-21-23(34-22)24(33)32(15-28-21)18-7-8-19-20(13-18)30-25(29-19)27-9-12-31-10-1-2-11-31/h3-8,13-15H,1-2,9-12H2,(H2,27,29,30) LAOLAICCPSJBOW-UHFFFAOYSA-N 50422901 CHEMBL384988 Melanin-concentrating hormone receptor 1 Homo sapiens 6.3 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422901 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422901&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417145 164151776 CHEMBL384988 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034239 CC(C)Nc1nc2ccc(cc2[nH]1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C22H18ClN5OS/c1-12(2)25-22-26-16-8-7-15(9-17(16)27-22)28-11-24-18-10-19(30-20(18)21(28)29)13-3-5-14(23)6-4-13/h3-12H,1-2H3,(H2,25,26,27) JVDKBJMEHYWUSI-UHFFFAOYSA-N 50422902 CHEMBL214512 Melanin-concentrating hormone receptor 1 Homo sapiens 7.9 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422902 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422902&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417022 164151777 CHEMBL214512 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034240 CN(C)c1nc2ccc(cc2[nH]1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C21H16ClN5OS/c1-26(2)21-24-15-8-7-14(9-16(15)25-21)27-11-23-17-10-18(29-19(17)20(27)28)12-3-5-13(22)6-4-12/h3-11H,1-2H3,(H,24,25) QOTAGIXKWLAMEW-UHFFFAOYSA-N 50422903 CHEMBL214716 Melanin-concentrating hormone receptor 1 Homo sapiens 2.5 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422903 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422903&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417021 164151778 CHEMBL214716 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034241 COc1ccc(Cn2c(nc3ccc(cc23)-n2cnc3cc(sc3c2=O)-c2ccc(Cl)cc2)N(C)C)cc1 InChI=1S/C29H24ClN5O2S/c1-33(2)29-32-23-13-10-21(14-25(23)34(29)16-18-4-11-22(37-3)12-5-18)35-17-31-24-15-26(38-27(24)28(35)36)19-6-8-20(30)9-7-19/h4-15,17H,16H2,1-3H3 MHLVGKWMEPPXSU-UHFFFAOYSA-N 50422904 CHEMBL386397 Melanin-concentrating hormone receptor 1 Homo sapiens 2512 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422904 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422904&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416975 164151779 CHEMBL386397 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034242 COCCCn1c(C)nc2cc(ccc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C24H21ClN4O2S/c1-15-27-19-12-18(8-9-21(19)28(15)10-3-11-31-2)29-14-26-20-13-22(32-23(20)24(29)30)16-4-6-17(25)7-5-16/h4-9,12-14H,3,10-11H2,1-2H3 LCICYNWPYXQFQS-UHFFFAOYSA-N 50422905 CHEMBL215256 Melanin-concentrating hormone receptor 1 Homo sapiens 5.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422905 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422905&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416838 164151780 CHEMBL215256 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034243 Cc1nc2ccc(cc2[nH]1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C20H13ClN4OS/c1-11-23-15-7-6-14(8-16(15)24-11)25-10-22-17-9-18(27-19(17)20(25)26)12-2-4-13(21)5-3-12/h2-10H,1H3,(H,23,24) POVBDVAIZBMEME-UHFFFAOYSA-N 50422906 CHEMBL386188 Melanin-concentrating hormone receptor 1 Homo sapiens 25 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422906 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422906&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416949 164151781 CHEMBL386188 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034244 Nc1nc2ccc(cc2[nH]1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C19H12ClN5OS/c20-11-3-1-10(2-4-11)16-8-15-17(27-16)18(26)25(9-22-15)12-5-6-13-14(7-12)24-19(21)23-13/h1-9H,(H3,21,23,24) HEDQZPBJLZAQTC-UHFFFAOYSA-N 50422907 CHEMBL425982 Melanin-concentrating hormone receptor 1 Homo sapiens 32 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422907 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422907&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416858 164151782 CHEMBL425982 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034245 Cc1nc2cc(ccc2n1CCN1CCOCC1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C26H24ClN5O2S/c1-17-29-21-14-20(6-7-23(21)31(17)9-8-30-10-12-34-13-11-30)32-16-28-22-15-24(35-25(22)26(32)33)18-2-4-19(27)5-3-18/h2-7,14-16H,8-13H2,1H3 QGGGRLPYOQYBBT-UHFFFAOYSA-N 50422908 CHEMBL384346 Melanin-concentrating hormone receptor 1 Homo sapiens 6.3 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422908 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422908&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416815 164151783 CHEMBL384346 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034246 CCCn1c(nc2ccc(cc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1)N(C)C InChI=1S/C24H22ClN5OS/c1-4-11-29-20-12-17(9-10-18(20)27-24(29)28(2)3)30-14-26-19-13-21(32-22(19)23(30)31)15-5-7-16(25)8-6-15/h5-10,12-14H,4,11H2,1-3H3 FZOVBXPXMLCZQB-UHFFFAOYSA-N 50422909 CHEMBL384233 Melanin-concentrating hormone receptor 1 Homo sapiens 5.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422909 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422909&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416955 164151784 CHEMBL384233 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034247 Cn1c(nc2cc(ccc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1)N1CCCC1 InChI=1S/C24H20ClN5OS/c1-28-20-9-8-17(12-18(20)27-24(28)29-10-2-3-11-29)30-14-26-19-13-21(32-22(19)23(30)31)15-4-6-16(25)7-5-15/h4-9,12-14H,2-3,10-11H2,1H3 NAVULPDUKBWACV-UHFFFAOYSA-N 50422910 CHEMBL385883 Melanin-concentrating hormone receptor 1 Homo sapiens 25 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422910 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422910&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416828 164151785 CHEMBL385883 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034248 Clc1ccc(cc1)-c1cc2ncn(-c3ccc4nc([nH]c4c3)N3CCCCC3)c(=O)c2s1 InChI=1S/C24H20ClN5OS/c25-16-6-4-15(5-7-16)21-13-20-22(32-21)23(31)30(14-26-20)17-8-9-18-19(12-17)28-24(27-18)29-10-2-1-3-11-29/h4-9,12-14H,1-3,10-11H2,(H,27,28) ACMBTHUEHVRJAL-UHFFFAOYSA-N 50422911 CHEMBL387217 Melanin-concentrating hormone receptor 1 Homo sapiens 5.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422911 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422911&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417066 164151786 CHEMBL387217 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034249 CNc1nc2ccc(cc2[nH]1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C20H14ClN5OS/c1-22-20-24-14-7-6-13(8-15(14)25-20)26-10-23-16-9-17(28-18(16)19(26)27)11-2-4-12(21)5-3-11/h2-10H,1H3,(H2,22,24,25) QLVLECDJPJANHQ-UHFFFAOYSA-N 50422912 CHEMBL214476 Melanin-concentrating hormone receptor 1 Homo sapiens 4.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422912 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422912&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416875 164151787 CHEMBL214476 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034250 CN(C)c1nc2cc(ccc2n1C)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C22H18ClN5OS/c1-26(2)22-25-16-10-15(8-9-18(16)27(22)3)28-12-24-17-11-19(30-20(17)21(28)29)13-4-6-14(23)7-5-13/h4-12H,1-3H3 KTKFYAKLGPAHKA-UHFFFAOYSA-N 50422913 CHEMBL384806 Melanin-concentrating hormone receptor 1 Homo sapiens 6.3 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422913 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422913&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417151 164151788 CHEMBL384806 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034251 Clc1ccc(cc1)-c1cc2ncn(-c3ccc4nc(NC5CC5)[nH]c4c3)c(=O)c2s1 InChI=1S/C22H16ClN5OS/c23-13-3-1-12(2-4-13)19-10-18-20(30-19)21(29)28(11-24-18)15-7-8-16-17(9-15)27-22(26-16)25-14-5-6-14/h1-4,7-11,14H,5-6H2,(H2,25,26,27) IZFIBMWWSGZPCL-UHFFFAOYSA-N 50422914 CHEMBL215932 Melanin-concentrating hormone receptor 1 Homo sapiens 16 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422914 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422914&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417043 164151789 CHEMBL215932 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034252 CC(C)Oc1ccc(cc1)-n1c(C)nc2cc(ccc12)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C29H23ClN4O2S/c1-17(2)36-23-11-8-21(9-12-23)34-18(3)32-24-14-22(10-13-26(24)34)33-16-31-25-15-27(37-28(25)29(33)35)19-4-6-20(30)7-5-19/h4-17H,1-3H3 OZTZLWUBTKQNGJ-UHFFFAOYSA-N 50422915 CHEMBL215298 Melanin-concentrating hormone receptor 1 Homo sapiens 7.9 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422915 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422915&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417083 164151790 CHEMBL215298 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034253 CN(C)c1nc2ccc(cc2n1C)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C22H18ClN5OS/c1-26(2)22-25-16-9-8-15(10-18(16)27(22)3)28-12-24-17-11-19(30-20(17)21(28)29)13-4-6-14(23)7-5-13/h4-12H,1-3H3 YMDKGGMAMAEFNG-UHFFFAOYSA-N 50422916 CHEMBL215643 Melanin-concentrating hormone receptor 1 Homo sapiens 1.6 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422916 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422916&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 11553871 164151791 CHEMBL215643 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034254 CN(C)c1nc2cc(ccc2n1CCO)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C23H20ClN5O2S/c1-27(2)23-26-17-11-16(7-8-19(17)28(23)9-10-30)29-13-25-18-12-20(32-21(18)22(29)31)14-3-5-15(24)6-4-14/h3-8,11-13,30H,9-10H2,1-2H3 NFJNDCDJCMFMRC-UHFFFAOYSA-N 50422917 CHEMBL216005 Melanin-concentrating hormone receptor 1 Homo sapiens 10.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422917 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422917&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416976 164151792 CHEMBL216005 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034255 CN(CCN1CCCC1)c1nc2ccc(cc2[nH]1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C26H25ClN6OS/c1-31(12-13-32-10-2-3-11-32)26-29-20-9-8-19(14-21(20)30-26)33-16-28-22-15-23(35-24(22)25(33)34)17-4-6-18(27)7-5-17/h4-9,14-16H,2-3,10-13H2,1H3,(H,29,30) JTUYSPGSVTWGLQ-UHFFFAOYSA-N 50422918 CHEMBL384132 Melanin-concentrating hormone receptor 1 Homo sapiens 5.0 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422918 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422918&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417146 164151793 CHEMBL384132 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034256 Clc1ccc(cc1)-c1cc2ncn(-c3ccc4nc([nH]c4c3)N3CCOCC3)c(=O)c2s1 InChI=1S/C23H18ClN5O2S/c24-15-3-1-14(2-4-15)20-12-19-21(32-20)22(30)29(13-25-19)16-5-6-17-18(11-16)27-23(26-17)28-7-9-31-10-8-28/h1-6,11-13H,7-10H2,(H,26,27) LKCIPZGUUMUXSA-UHFFFAOYSA-N 50422919 CHEMBL387438 Melanin-concentrating hormone receptor 1 Homo sapiens 16 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422919 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422919&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44417067 164151794 CHEMBL387438 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 51034257 Cc1nc2cc(ccc2n1-c1ccccc1)-n1cnc2cc(sc2c1=O)-c1ccc(Cl)cc1 InChI=1S/C26H17ClN4OS/c1-16-29-21-13-20(11-12-23(21)31(16)19-5-3-2-4-6-19)30-15-28-22-14-24(33-25(22)26(30)32)17-7-9-18(27)10-8-17/h2-15H,1H3 RQQYFEPKPOWOPO-UHFFFAOYSA-N 50422920 CHEMBL386460 Melanin-concentrating hormone receptor 1 Homo sapiens 32 ChEMBL 10.1016/j.bmcl.2006.07.054 10.7270/Q2833T97 16904318 Carpenter, AJ; Al-Barazanji, KA; Barvian, KK; Bishop, MJ; Britt, CS; Cooper, JP; Goetz, AS; Grizzle, MK; Hertzog, DL; Ignar, DM; Morgan, RO; Peckham, GE; Speake, JD; Swain, WR 8/25/2006 9/23/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422920 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422920&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44416851 164151795 CHEMBL386460 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08