BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50346453 CC1CCCCN1CCN[C@H](C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccccc1 InChI=1S/C25H29F6N3O/c1-17-7-5-6-11-34(17)12-10-32-22(19-8-3-2-4-9-19)23(35)33-16-18-13-20(24(26,27)28)15-21(14-18)25(29,30)31/h2-4,8-9,13-15,17,22,32H,5-7,10-12,16H2,1H3,(H,33,35) UIHDKMQRDLGFQA-UHFFFAOYSA-N 50187030 (2S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(2-methylpiperidin-1-yl)ethylamino)-2-phenylacetamide::CHEMBL211404 C-C chemokine receptor type 2 Homo sapiens 838 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187030 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187030&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413399 104071069 CHEMBL211404 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346454 CN(C)CCN[C@H](C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccsc1 InChI=1S/C19H21F6N3OS/c1-28(2)5-4-26-16(13-3-6-30-11-13)17(29)27-10-12-7-14(18(20,21)22)9-15(8-12)19(23,24)25/h3,6-9,11,16,26H,4-5,10H2,1-2H3,(H,27,29) MTTGKUZGRFVEOS-UHFFFAOYSA-N 50187031 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(dimethylamino)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL379818 C-C chemokine receptor type 2 Homo sapiens 424 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187031 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187031&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413147 104071070 CHEMBL379818 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346456 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 Substance-P receptor Homo sapiens >100 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2103&target=Substance-P+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=Substance-P+receptor&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS 8U26,7RMI,7RMH,7RMG,2KSB,2KSA,2KS9,7P02,7P00,6E59,6J20,6J21 Substance-P receptor NK1R_HUMAN P25103 A8K150 50346457 CN(CCN1CCCCC1)c1ccc(cc1)-c1nc2cc(Cl)c(Cl)cc2[nH]1 InChI=1S/C21H24Cl2N4/c1-26(11-12-27-9-3-2-4-10-27)16-7-5-15(6-8-16)21-24-19-13-17(22)18(23)14-20(19)25-21/h5-8,13-14H,2-4,9-12H2,1H3,(H,24,25) WTYYMEHQSWTSIJ-UHFFFAOYSA-N 50187034 4-(5,6-dichloro-1H-benzo[d]imidazol-2-yl)-N-methyl-N-(2-(piperidin-1-yl)ethyl)benzenamine::CHEMBL377432 C-C chemokine receptor type 2 Homo sapiens 13400 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187034 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187034&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 15518124 104071073 CHEMBL377432 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346458 CN(C)CCNC(C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccccc1 InChI=1S/C21H23F6N3O/c1-30(2)9-8-28-18(15-6-4-3-5-7-15)19(31)29-13-14-10-16(20(22,23)24)12-17(11-14)21(25,26)27/h3-7,10-12,18,28H,8-9,13H2,1-2H3,(H,29,31) QJBRFCROHHUSOP-UHFFFAOYSA-N 50187035 N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(dimethylamino)ethylamino)-2-phenylacetamide::CHEMBL378658 C-C chemokine receptor type 2 Homo sapiens 1477 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187035 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187035&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413230 104071074 CHEMBL378658 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346459 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 Neuromedin-K receptor Homo sapiens >1000 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5566&target=Neuromedin-K+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=Neuromedin-K+receptor&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADTTRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS 8JBH,8JBG,8JBF Neuromedin-K receptor NK3R_HUMAN P29371 Q0P510 50346460 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 C-C chemokine receptor type 3 Homo sapiens >1000 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6236&target=C-C+chemokine+receptor+type+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=C-C+chemokine+receptor+type+3&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILIKYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRLIFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVIYAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF C-C chemokine receptor type 3 CCR3_HUMAN P51677 B3KVQ1 F5GWL6 Q15748 Q2YDB9 Q86WD2 Q8TDP6 Q9ULY8 50346461 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 C-C chemokine receptor type 4 Homo sapiens >2000 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7517&target=C-C+chemokine+receptor+type+4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=C-C+chemokine+receptor+type+4&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLNPIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL C-C chemokine receptor type 4 CCR4_HUMAN P51679 Q9ULY6 Q9ULY7 50346462 CN(C)CCN[C@H](C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccc(F)cc1 InChI=1S/C21H22F7N3O/c1-31(2)8-7-29-18(14-3-5-17(22)6-4-14)19(32)30-12-13-9-15(20(23,24)25)11-16(10-13)21(26,27)28/h3-6,9-11,18,29H,7-8,12H2,1-2H3,(H,30,32) SWGQDPWKPYZEEH-UHFFFAOYSA-N 50187037 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(dimethylamino)ethylamino)-2-(4-fluorophenyl)acetamide::CHEMBL378784 C-C chemokine receptor type 2 Homo sapiens 770 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187037 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187037&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413144 104071075 CHEMBL378784 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346464 OC(=O)c1cc2cc(O)ccc2n1Cc1ccc(Cl)c(Cl)c1 InChI=1S/C16H11Cl2NO3/c17-12-3-1-9(5-13(12)18)8-19-14-4-2-11(20)6-10(14)7-15(19)16(21)22/h1-7,20H,8H2,(H,21,22) BBRSCGBAIAKATH-UHFFFAOYSA-N 50187039 1-(3,4-dichlorobenzyl)-5-hydroxy-1H-indole-2-carboxylic acid::CHEMBL376981 C-C chemokine receptor type 2 Homo sapiens 29 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187039 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187039&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 9949615 104071077 CHEMBL376981 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346465 CN(C)CCN[C@@H](C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1cccs1 InChI=1S/C19H21F6N3OS/c1-28(2)6-5-26-16(15-4-3-7-30-15)17(29)27-11-12-8-13(18(20,21)22)10-14(9-12)19(23,24)25/h3-4,7-10,16,26H,5-6,11H2,1-2H3,(H,27,29) ROWNFEBZZBSCLU-UHFFFAOYSA-N 50187041 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(dimethylamino)ethylamino)-2-(thiophen-2-yl)acetamide::CHEMBL211292 C-C chemokine receptor type 2 Homo sapiens 865 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187041 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187041&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413137 104071079 CHEMBL211292 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346466 FC(F)(F)c1cc(CNC(=O)C(NCCN2CCCC2)c2ccccc2)cc(c1)C(F)(F)F InChI=1S/C23H25F6N3O/c24-22(25,26)18-12-16(13-19(14-18)23(27,28)29)15-31-21(33)20(17-6-2-1-3-7-17)30-8-11-32-9-4-5-10-32/h1-3,6-7,12-14,20,30H,4-5,8-11,15H2,(H,31,33) ILRUSZMEABXELI-UHFFFAOYSA-N 50187042 N-(3,5-bis(trifluoromethyl)benzyl)-2-phenyl-2-(2-(pyrrolidin-1-yl)ethylamino)acetamide::CHEMBL209171 C-C chemokine receptor type 2 Homo sapiens 521 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187042 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187042&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413311 104071080 CHEMBL209171 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346467 CCN(CC)CCNC(C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccccc1 InChI=1S/C23H27F6N3O/c1-3-32(4-2)11-10-30-20(17-8-6-5-7-9-17)21(33)31-15-16-12-18(22(24,25)26)14-19(13-16)23(27,28)29/h5-9,12-14,20,30H,3-4,10-11,15H2,1-2H3,(H,31,33) XFBHKDFRWTZZIS-UHFFFAOYSA-N 50187040 N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(diethylamino)ethylamino)-2-phenylacetamide::CHEMBL378517 C-C chemokine receptor type 2 Homo sapiens 678 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187040 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187040&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413310 104071078 CHEMBL378517 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346468 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 C-C chemokine receptor type 2 Homo sapiens 50 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346469 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 Substance-K receptor Homo sapiens >1000 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5459&target=Substance-K+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=Substance-K+receptor&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI Substance-K receptor NK2R_HUMAN P21452 A8K7I1 Q4QRI5 Q8NGQ8 Q9UDE6 Q9UDE7 50346470 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 C-C chemokine receptor type 2 Homo sapiens 39 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346471 FC(F)(F)c1cc(CNC(=O)C(NCCN2CCCCC2)c2ccccc2)cc(c1)C(F)(F)F InChI=1S/C24H27F6N3O/c25-23(26,27)19-13-17(14-20(15-19)24(28,29)30)16-32-22(34)21(18-7-3-1-4-8-18)31-9-12-33-10-5-2-6-11-33/h1,3-4,7-8,13-15,21,31H,2,5-6,9-12,16H2,(H,32,34) BHCROBUDGYXOFC-UHFFFAOYSA-N 50187044 N-(3,5-bis(trifluoromethyl)benzyl)-2-phenyl-2-(2-(piperidin-1-yl)ethylamino)acetamide::CHEMBL378995 C-C chemokine receptor type 2 Homo sapiens 342 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187044 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187044&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413328 104071082 CHEMBL378995 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346472 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 C-C chemokine receptor type 1 Homo sapiens >1000 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5596&target=C-C+chemokine+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=C-C+chemokine+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF 7VLA,7VL9,7VL8 C-C chemokine receptor type 1 CCR1_HUMAN P32246 Q86VA9 50346473 CN(C)CCN[C@H](C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccccc1 InChI=1S/C21H23F6N3O/c1-30(2)9-8-28-18(15-6-4-3-5-7-15)19(31)29-13-14-10-16(20(22,23)24)12-17(11-14)21(25,26)27/h3-7,10-12,18,28H,8-9,13H2,1-2H3,(H,29,31) QJBRFCROHHUSOP-UHFFFAOYSA-N 50187045 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(dimethylamino)ethylamino)-2-phenylacetamide::CHEMBL211560 C-C chemokine receptor type 2 Homo sapiens 1000 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187045 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187045&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413167 104071083 CHEMBL211560 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346474 Oc1ccc2[nH]cc(C3CCN(CCCCCNC(=O)\C=C\c4ccc(Cl)c(Cl)c4)CC3)c2c1 InChI=1S/C27H31Cl2N3O2/c28-24-7-4-19(16-25(24)29)5-9-27(34)30-12-2-1-3-13-32-14-10-20(11-15-32)23-18-31-26-8-6-21(33)17-22(23)26/h4-9,16-18,20,31,33H,1-3,10-15H2,(H,30,34) QBRLVMQBZIFWTB-UHFFFAOYSA-N 50091438 (E)-3-(3,4-dichlorophenyl)-N-(5-(4-(5-hydroxy-1H-indol-3-yl)piperidin-1-yl)pentyl)acrylamide::TCMDC-139245::3-(3,4-dichlorophenyl)-N-(5-(4-(5-hydroxy-1H-indol-3-yl)piperidin-1-yl)pentyl)acrylamide::(E)-3-(3,4-Dichloro-phenyl)-N-{5-[4-(5-hydroxy-1H-indol-3-yl)-piperidin-1-yl]-pentyl}-acrylamide::CHEMBL432713 C-C chemokine receptor type 2 Homo sapiens 50 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50091438 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50091438&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 10436045 103989697 CHEMBL432713 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346475 CN(C)CCC=N[C@H](C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccccc1 |w:5.4| InChI=1S/C22H23F6N3O/c1-31(2)10-6-9-29-19(16-7-4-3-5-8-16)20(32)30-14-15-11-17(21(23,24)25)13-18(12-15)22(26,27)28/h3-5,7-9,11-13,19H,6,10,14H2,1-2H3,(H,30,32) DMDOKFVLDOQFCF-UHFFFAOYSA-N 50187050 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(3-(dimethylamino)propylideneamino)-2-phenylacetamide::CHEMBL209411 C-C chemokine receptor type 2 Homo sapiens 10 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187050 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187050&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413089 104071088 CHEMBL209411 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346476 CN(C)CCNC(C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccco1 InChI=1S/C19H21F6N3O2/c1-28(2)6-5-26-16(15-4-3-7-30-15)17(29)27-11-12-8-13(18(20,21)22)10-14(9-12)19(23,24)25/h3-4,7-10,16,26H,5-6,11H2,1-2H3,(H,27,29) HPLHOKOTNJQVJU-UHFFFAOYSA-N 50187049 N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(dimethylamino)ethylamino)-2-(furan-2-yl)acetamide::CHEMBL212674 C-C chemokine receptor type 2 Homo sapiens 592 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187049 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187049&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413158 104071087 CHEMBL212674 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346477 CN(C)CCC[C@H](C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccccc1 InChI=1S/C22H24F6N2O/c1-30(2)10-6-9-19(16-7-4-3-5-8-16)20(31)29-14-15-11-17(21(23,24)25)13-18(12-15)22(26,27)28/h3-5,7-8,11-13,19H,6,9-10,14H2,1-2H3,(H,29,31) MOHSATSDFRBXRS-UHFFFAOYSA-N 50187046 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-5-(dimethylamino)-2-phenylpentanamide::CHEMBL209063 C-C chemokine receptor type 2 Homo sapiens 13 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187046 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187046&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413258 104071084 CHEMBL209063 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346478 CN(C)CCS[C@H](C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccccc1 InChI=1S/C21H22F6N2OS/c1-29(2)8-9-31-18(15-6-4-3-5-7-15)19(30)28-13-14-10-16(20(22,23)24)12-17(11-14)21(25,26)27/h3-7,10-12,18H,8-9,13H2,1-2H3,(H,28,30) ALCHXFSAGPIQMB-UHFFFAOYSA-N 50187047 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(dimethylamino)ethylthio)-2-phenylacetamide::CHEMBL208685 C-C chemokine receptor type 2 Homo sapiens 25 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187047 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187047&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413257 104071085 CHEMBL208685 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346479 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccccc2)cc(c1)C(F)(F)F InChI=1S/C24H27F6N3O/c25-23(26,27)19-13-17(14-20(15-19)24(28,29)30)16-32-22(34)21(18-7-3-1-4-8-18)31-9-12-33-10-5-2-6-11-33/h1,3-4,7-8,13-15,21,31H,2,5-6,9-12,16H2,(H,32,34) BHCROBUDGYXOFC-UHFFFAOYSA-N 50187048 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-phenyl-2-(2-(piperidin-1-yl)ethylamino)acetamide::CHEMBL209267 C-C chemokine receptor type 2 Homo sapiens 219 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187048 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187048&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 10458152 104071086 CHEMBL209267 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346480 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCC(CC2)c2ccccc2)c2ccccc2)cc(c1)C(F)(F)F InChI=1S/C30H31F6N3O/c31-29(32,33)25-17-21(18-26(19-25)30(34,35)36)20-38-28(40)27(24-9-5-2-6-10-24)37-13-16-39-14-11-23(12-15-39)22-7-3-1-4-8-22/h1-10,17-19,23,27,37H,11-16,20H2,(H,38,40) GMSUBXAFZHGFIG-UHFFFAOYSA-N 50187052 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-phenyl-2-(2-(4-phenylpiperidin-1-yl)ethylamino)acetamide::CHEMBL212423 C-C chemokine receptor type 2 Homo sapiens 822 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187052 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187052&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 11843812 104071090 CHEMBL212423 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346481 CN(C)CCCN(C)[C@H](C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccccc1 InChI=1S/C23H27F6N3O/c1-31(2)10-7-11-32(3)20(17-8-5-4-6-9-17)21(33)30-15-16-12-18(22(24,25)26)14-19(13-16)23(27,28)29/h4-6,8-9,12-14,20H,7,10-11,15H2,1-3H3,(H,30,33) OCEWKAHCFHSHRE-UHFFFAOYSA-N 50187051 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-((3-(dimethylamino)propyl)(methyl)amino)-2-phenylacetamide::CHEMBL380258 C-C chemokine receptor type 2 Homo sapiens 8 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187051 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187051&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413076 104071089 CHEMBL380258 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346482 Fc1ccc(cc1)[C@H](NCCN1CCCCC1)C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F InChI=1S/C24H26F7N3O/c25-20-6-4-17(5-7-20)21(32-8-11-34-9-2-1-3-10-34)22(35)33-15-16-12-18(23(26,27)28)14-19(13-16)24(29,30)31/h4-7,12-14,21,32H,1-3,8-11,15H2,(H,33,35) DMOJSPBEGXJTSX-UHFFFAOYSA-N 50187053 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(4-fluorophenyl)-2-(2-(piperidin-1-yl)ethylamino)acetamide::CHEMBL210606 C-C chemokine receptor type 2 Homo sapiens 175 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187053 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187053&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 10346048 104071091 CHEMBL210606 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346483 CC1CCN(CCN[C@H](C(=O)NCc2cc(cc(c2)C(F)(F)F)C(F)(F)F)c2ccccc2)CC1 InChI=1S/C25H29F6N3O/c1-17-7-10-34(11-8-17)12-9-32-22(19-5-3-2-4-6-19)23(35)33-16-18-13-20(24(26,27)28)15-21(14-18)25(29,30)31/h2-6,13-15,17,22,32H,7-12,16H2,1H3,(H,33,35) LMXHEPMINMFJIS-UHFFFAOYSA-N 50187054 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(4-methylpiperidin-1-yl)ethylamino)-2-phenylacetamide::CHEMBL209002 C-C chemokine receptor type 2 Homo sapiens 756 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187054 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187054&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413411 104071092 CHEMBL209002 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346484 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 C-C chemokine receptor type 5 Homo sapiens >1000 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7256&target=C-C+chemokine+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=C-C+chemokine+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL 7O7F,6MET,6MEO C-C chemokine receptor type 5 CCR5_HUMAN P51681 O14692 O14693 O14695 O14696 O14697 O14698 O14699 O14700 O14701 O14702 O14703 O14704 O14705 O14706 O14707 O14708 O15538 Q9UPA4 50346485 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 C-C chemokine receptor type 8 Homo sapiens >1000 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003362&target=C-C+chemokine+receptor+type+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=C-C+chemokine+receptor+type+8&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIYAFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL 8TLM,8KFZ,8KFY,8KFX,8U1U C-C chemokine receptor type 8 CCR8_HUMAN P51685 B2RC64 Q3KNQ8 Q3KNR3 Q9BYX5 50346486 Nc1ccc(cc1C(=O)NCC(=O)NCC1CCN(Cc2ccc(Cl)cc2)CC1)C(F)(F)F InChI=1S/C23H26ClF3N4O2/c24-18-4-1-16(2-5-18)14-31-9-7-15(8-10-31)12-29-21(32)13-30-22(33)19-11-17(23(25,26)27)3-6-20(19)28/h1-6,11,15H,7-10,12-14,28H2,(H,29,32)(H,30,33) AKNWXVJEVORFRQ-UHFFFAOYSA-N 50187055 N-(2-((1-(4-chlorobenzyl)piperidin-4-yl)methylamino)-2-oxoethyl)-2-amino-5-(trifluoromethyl)benzamide::CHEMBL427396 C-C chemokine receptor type 2 Homo sapiens 200 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187055 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187055&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 9934977 104071093 CHEMBL427396 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346487 FC(F)(F)c1cc(CNC(=O)C(NCCN2CCOCC2)c2ccccc2)cc(c1)C(F)(F)F InChI=1S/C23H25F6N3O2/c24-22(25,26)18-12-16(13-19(14-18)23(27,28)29)15-31-21(33)20(17-4-2-1-3-5-17)30-6-7-32-8-10-34-11-9-32/h1-5,12-14,20,30H,6-11,15H2,(H,31,33) XTOQDJQEIMRZFK-UHFFFAOYSA-N 50187056 N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-morpholinoethylamino)-2-phenylacetamide::CHEMBL379278 C-C chemokine receptor type 2 Homo sapiens 575 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187056 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187056&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413344 104071094 CHEMBL379278 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346488 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCC2)c2ccsc2)cc(c1)C(F)(F)F InChI=1S/C22H25F6N3OS/c23-21(24,25)17-10-15(11-18(12-17)22(26,27)28)13-30-20(32)19(16-4-9-33-14-16)29-5-8-31-6-2-1-3-7-31/h4,9-12,14,19,29H,1-3,5-8,13H2,(H,30,32) NLWNSKCTNYPJQF-UHFFFAOYSA-N 50187033 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(piperidin-1-yl)ethylamino)-2-(thiophen-3-yl)acetamide::CHEMBL211775 C-C chemokine receptor type 2 Homo sapiens 30 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187033&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 10323427 104071072 CHEMBL211775 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346489 FC(F)(F)c1cc(CNC(=O)[C@@H](NCCN2CCCCCC2)c2ccccc2)cc(c1)C(F)(F)F InChI=1S/C25H29F6N3O/c26-24(27,28)20-14-18(15-21(16-20)25(29,30)31)17-33-23(35)22(19-8-4-3-5-9-19)32-10-13-34-11-6-1-2-7-12-34/h3-5,8-9,14-16,22,32H,1-2,6-7,10-13,17H2,(H,33,35) VMOJBBXFYCGPAL-UHFFFAOYSA-N 50187057 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(azepan-1-yl)ethylamino)-2-phenylacetamide::CHEMBL212306 C-C chemokine receptor type 2 Homo sapiens 400 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187057 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187057&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 10436083 104071095 CHEMBL212306 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346490 Cc1ccc2NC(=O)OC3(CCN(CCc4coc(n4)-c4ccc(F)cc4)CC3)c2c1 InChI=1S/C24H24FN3O3/c1-16-2-7-21-20(14-16)24(31-23(29)27-21)9-12-28(13-10-24)11-8-19-15-30-22(26-19)17-3-5-18(25)6-4-17/h2-7,14-15H,8-13H2,1H3,(H,27,29) XWJDHZVOOKZGCS-UHFFFAOYSA-N 50187043 1'-{2-[2-(4-fluorophenyl)-1,3-oxazol-4-yl]ethyl}-6-methyl-1,2-dihydrospiro[3,1-benzoxazine-4,4'-piperidine]-2-one::CHEMBL209263 C-C chemokine receptor type 2 Homo sapiens 32 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187043 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6463&target=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187043&enzyme=C-C+chemokine+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44413214 104071081 CHEMBL209263 1 MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA 7XA3 C-C chemokine receptor type 2 CCR2_HUMAN P41597 A0AVQ3 B2RMT0 O95950 Q4VBL2 50346491 CN(C)CCN[C@H](C(=O)NCc1cc(cc(c1)C(F)(F)F)C(F)(F)F)c1ccc(F)cc1 InChI=1S/C21H22F7N3O/c1-31(2)8-7-29-18(14-3-5-17(22)6-4-14)19(32)30-12-13-9-15(20(23,24)25)11-16(10-13)21(26,27)28/h3-6,9-11,18,29H,7-8,12H2,1-2H3,(H,30,32) SWGQDPWKPYZEEH-UHFFFAOYSA-N 50187037 (S)-N-(3,5-bis(trifluoromethyl)benzyl)-2-(2-(dimethylamino)ethylamino)-2-(4-fluorophenyl)acetamide::CHEMBL378784 Substance-P receptor Homo sapiens 650 ChEMBL 10.1016/j.bmcl.2006.04.045 10.7270/Q2N01645 16698264 Yang, L; Zhou, C; Guo, L; Morriello, G; Butora, G; Pasternak, A; Parsons, WH; Mills, SG; MacCoss, M; Vicario, PP; Zweerink, H; Ayala, JM; Goyal, S; Hanlon, WA; Cascieri, MA; Springer, MS 6/5/2006 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50187037 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2103&target=Substance-P+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50187037&enzyme=Substance-P+receptor&column=ki&startPg=0&Increment=50&submit=Search 44413144 104071075 CHEMBL378784 1 MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS 8U26,7RMI,7RMH,7RMG,2KSB,2KSA,2KS9,7P02,7P00,6E59,6J20,6J21 Substance-P receptor NK1R_HUMAN P25103 A8K150