BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
51034144	CN1CCN(CC1)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2C[C@@H]1CCN(C)C[C@@H]1F	InChI=1S/C30H36ClFN4O2/c1-33-13-15-35(16-14-33)26-17-27(38-22-9-7-21(31)8-10-22)29-28(30(26)37)23-5-3-4-6-25(23)36(29)18-20-11-12-34(2)19-24(20)32/h3-10,20,24,26-27H,11-19H2,1-2H3	FMWQNIIEHDXZKU-UHFFFAOYSA-N	50422838	CHEMBL383763	Neuropeptide Y receptor type 1	Homo sapiens		 170							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422838	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422838&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409242	164151713		CHEMBL383763					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034145	Clc1ccc(O[C@@H]2CCC(=O)c3c2n(CCCN2CCCCC2)c2ccccc32)cc1	InChI=1S/C26H29ClN2O2/c27-19-9-11-20(12-10-19)31-24-14-13-23(30)25-21-7-2-3-8-22(21)29(26(24)25)18-6-17-28-15-4-1-5-16-28/h2-3,7-12,24H,1,4-6,13-18H2	ZWWDBHPYMHQUBH-UHFFFAOYSA-N	50422839	CHEMBL206112	Neuropeptide Y receptor type 1	Homo sapiens		 7244							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422839	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422839&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409209	164151714		CHEMBL206112					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034146	Clc1ccc(O[C@@H]2CC(N3CCCCC3)C(=O)c3c2n(CCCN2CCCCC2)c2ccccc32)cc1	InChI=1S/C31H38ClN3O2/c32-23-12-14-24(15-13-23)37-28-22-27(34-19-7-2-8-20-34)31(36)29-25-10-3-4-11-26(25)35(30(28)29)21-9-18-33-16-5-1-6-17-33/h3-4,10-15,27-28H,1-2,5-9,16-22H2	KCDRUJOXDKLRND-UHFFFAOYSA-N	50422840	CHEMBL204583	Neuropeptide Y receptor type 1	Homo sapiens		 3388							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422840	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422840&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409236	164151715		CHEMBL204583					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034147	CN1CCN(CC1)[C@H]1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2CC1CCNCC1	InChI=1S/C29H35ClN4O2/c1-32-14-16-33(17-15-32)25-18-26(36-22-8-6-21(30)7-9-22)28-27(29(25)35)23-4-2-3-5-24(23)34(28)19-20-10-12-31-13-11-20/h2-9,20,25-26,31H,10-19H2,1H3	JJJYHZWMXCJWRV-UHFFFAOYSA-N	50422841	CHEMBL439506	Neuropeptide Y receptor type 1	Homo sapiens		 49							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422841	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422841&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409345	164151716		CHEMBL439506					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034148	Clc1ccc(O[C@@H]2CC(N3CCOCC3)C(=O)c3c2n(CCCN2CCCCC2)c2ccccc32)cc1	InChI=1S/C30H36ClN3O3/c31-22-9-11-23(12-10-22)37-27-21-26(33-17-19-36-20-18-33)30(35)28-24-7-2-3-8-25(24)34(29(27)28)16-6-15-32-13-4-1-5-14-32/h2-3,7-12,26-27H,1,4-6,13-21H2	SLQATEXLOSCKLW-UHFFFAOYSA-N	50422842	CHEMBL378587	Neuropeptide Y receptor type 1	Homo sapiens		 15849							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422842	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422842&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409210	164151717		CHEMBL378587					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034149	CN1CCC(Cn2c3[C@@H](CC(N4CCN(C)CC4)C(=O)c3c3ccccc23)Oc2ccc(Cl)cc2)CC1	InChI=1S/C30H37ClN4O2/c1-32-13-11-21(12-14-32)20-35-25-6-4-3-5-24(25)28-29(35)27(37-23-9-7-22(31)8-10-23)19-26(30(28)36)34-17-15-33(2)16-18-34/h3-10,21,26-27H,11-20H2,1-2H3	JQOSMURZPWPUEW-UHFFFAOYSA-N	50422843	CHEMBL424862	Neuropeptide Y receptor type 1	Homo sapiens		 34							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422843	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422843&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409177	164151718		CHEMBL424862					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034150	CN1CCN(CC1)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2C	InChI=1S/C24H26ClN3O2/c1-26-11-13-28(14-12-26)20-15-21(30-17-9-7-16(25)8-10-17)23-22(24(20)29)18-5-3-4-6-19(18)27(23)2/h3-10,20-21H,11-15H2,1-2H3	BUBAWRGTUJWAJK-UHFFFAOYSA-N	50422844	CHEMBL440944	Neuropeptide Y receptor type 1	Homo sapiens		 25119							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422844	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422844&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409191	164151719		CHEMBL440944					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034151	OCCN1CCN(CC1)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2CC1CCNCC1	InChI=1S/C30H37ClN4O3/c31-22-5-7-23(8-6-22)38-27-19-26(34-15-13-33(14-16-34)17-18-36)30(37)28-24-3-1-2-4-25(24)35(29(27)28)20-21-9-11-32-12-10-21/h1-8,21,26-27,32,36H,9-20H2	LRPLIEMIFUAEMP-UHFFFAOYSA-N	50422845	CHEMBL380654	Neuropeptide Y receptor type 1	Homo sapiens		 37							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422845	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422845&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409367	164151720		CHEMBL380654					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034152	FC1(F)CCN(CC1)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2CC1CCNCC1	InChI=1S/C29H32ClF2N3O2/c30-20-5-7-21(8-6-20)37-25-17-24(34-15-11-29(31,32)12-16-34)28(36)26-22-3-1-2-4-23(22)35(27(25)26)18-19-9-13-33-14-10-19/h1-8,19,24-25,33H,9-18H2	QEWJDKVCDFGZSN-UHFFFAOYSA-N	50422846	CHEMBL426314	Neuropeptide Y receptor type 1	Homo sapiens		 1862							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422846	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422846&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409161	164151721		CHEMBL426314					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034153	CC1CCN(CC1)[C@@H]1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2CC1CCNCC1	InChI=1S/C30H36ClN3O2/c1-20-12-16-33(17-13-20)26-18-27(36-23-8-6-22(31)7-9-23)29-28(30(26)35)24-4-2-3-5-25(24)34(29)19-21-10-14-32-15-11-21/h2-9,20-21,26-27,32H,10-19H2,1H3	FLJLGJKLCGQKKZ-UHFFFAOYSA-N	50422847	CHEMBL204050	Neuropeptide Y receptor type 1	Homo sapiens		 98							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422847	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422847&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409155	164151722		CHEMBL204050					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034154	CN1CCN(CC1)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2C[C@H]1CCNC[C@@H]1F	InChI=1S/C29H34ClFN4O2/c1-33-12-14-34(15-13-33)25-16-26(37-21-8-6-20(30)7-9-21)28-27(29(25)36)22-4-2-3-5-24(22)35(28)18-19-10-11-32-17-23(19)31/h2-9,19,23,25-26,32H,10-18H2,1H3	NLNIZEJOWHVZBP-UHFFFAOYSA-N	50422848	CHEMBL379443	Neuropeptide Y receptor type 1	Homo sapiens		 240							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422848	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422848&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409268	164151723		CHEMBL379443					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034155	CN1CCN(CC1)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2CCCN1CCCCC1	InChI=1S/C31H39ClN4O2/c1-33-18-20-35(21-19-33)27-22-28(38-24-12-10-23(32)11-13-24)30-29(31(27)37)25-8-3-4-9-26(25)36(30)17-7-16-34-14-5-2-6-15-34/h3-4,8-13,27-28H,2,5-7,14-22H2,1H3	RQXBPIGIJBKCME-UHFFFAOYSA-N	50422849	CHEMBL203433	Neuropeptide Y receptor type 1	Homo sapiens		 1318							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422849	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422849&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409205	164151724		CHEMBL203433					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034156	Clc1ccc(O[C@@H]2CC(N3CCNCC3)C(=O)c3c2n(CCCN2CCCCC2)c2ccccc32)cc1	InChI=1S/C30H37ClN4O2/c31-22-9-11-23(12-10-22)37-27-21-26(34-19-13-32-14-20-34)30(36)28-24-7-2-3-8-25(24)35(29(27)28)18-6-17-33-15-4-1-5-16-33/h2-3,7-12,26-27,32H,1,4-6,13-21H2	ZZVHSBGUJDNNFG-UHFFFAOYSA-N	50422850	CHEMBL206799	Neuropeptide Y receptor type 1	Homo sapiens		 331							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422850	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422850&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409330	164151725		CHEMBL206799					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034157	CN1CCN(CC1)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2C[C@H]1CCN(C)C[C@@H]1F	InChI=1S/C30H36ClFN4O2/c1-33-13-15-35(16-14-33)26-17-27(38-22-9-7-21(31)8-10-22)29-28(30(26)37)23-5-3-4-6-25(23)36(29)18-20-11-12-34(2)19-24(20)32/h3-10,20,24,26-27H,11-19H2,1-2H3	FMWQNIIEHDXZKU-UHFFFAOYSA-N	50422851	CHEMBL382204	Neuropeptide Y receptor type 1	Homo sapiens		 437							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422851	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422851&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409234	164151726		CHEMBL382204					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034158	CN1CCN(CC1=O)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2CC1CCNCC1	InChI=1S/C29H33ClN4O3/c1-32-14-15-33(18-26(32)35)24-16-25(37-21-8-6-20(30)7-9-21)28-27(29(24)36)22-4-2-3-5-23(22)34(28)17-19-10-12-31-13-11-19/h2-9,19,24-25,31H,10-18H2,1H3	UFEJMOYXKDWUSF-UHFFFAOYSA-N	50422852	CHEMBL203430	Neuropeptide Y receptor type 1	Homo sapiens		 3890							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422852	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422852&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409173	164151727		CHEMBL203430					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034159	CC1(F)CCN(CC1)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2CC1CCNCC1	InChI=1S/C30H35ClFN3O2/c1-30(32)12-16-34(17-13-30)25-18-26(37-22-8-6-21(31)7-9-22)28-27(29(25)36)23-4-2-3-5-24(23)35(28)19-20-10-14-33-15-11-20/h2-9,20,25-26,33H,10-19H2,1H3	LQAUSOVDKYFMFH-UHFFFAOYSA-N	50422853	CHEMBL381510	Neuropeptide Y receptor type 1	Homo sapiens		 100							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422853	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422853&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409158	164151728		CHEMBL381510					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034160	CC1CCN(CC1)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2CCCN1CCCCC1	InChI=1S/C32H40ClN3O2/c1-23-14-20-35(21-15-23)28-22-29(38-25-12-10-24(33)11-13-25)31-30(32(28)37)26-8-3-4-9-27(26)36(31)19-7-18-34-16-5-2-6-17-34/h3-4,8-13,23,28-29H,2,5-7,14-22H2,1H3	GWEWFPMLAGKWMJ-UHFFFAOYSA-N	50422854	CHEMBL206671	Neuropeptide Y receptor type 1	Homo sapiens		 646							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422854	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422854&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409307	164151729		CHEMBL206671					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034161	CN1CCN(CC1)C1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2C[C@@H]1CCNC[C@@H]1F	InChI=1S/C29H34ClFN4O2/c1-33-12-14-34(15-13-33)25-16-26(37-21-8-6-20(30)7-9-21)28-27(29(25)36)22-4-2-3-5-24(22)35(28)18-19-10-11-32-17-23(19)31/h2-9,19,23,25-26,32H,10-18H2,1H3	NLNIZEJOWHVZBP-UHFFFAOYSA-N	50422855	CHEMBL382355	Neuropeptide Y receptor type 1	Homo sapiens		 186							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422855	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422855&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409237	164151730		CHEMBL382355					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034162	CNC1CCC(Cn2c3[C@@H](CC(N4CCN(C)CC4)C(=O)c3c3ccccc23)Oc2ccc(Cl)cc2)CC1 |wU:9.31,(11.22,-42.16,;12.24,-43.31,;13.75,-42.99,;14.23,-41.53,;15.74,-41.22,;16.76,-42.37,;18.26,-42.05,;18.74,-40.58,;20.21,-40.11,;21.55,-40.89,;22.9,-40.11,;22.9,-38.56,;24.24,-37.79,;25.57,-38.58,;26.9,-37.82,;26.91,-36.28,;28.25,-35.52,;25.58,-35.5,;24.24,-36.26,;21.55,-37.77,;21.56,-36.23,;20.21,-38.55,;18.74,-38.07,;18.11,-36.67,;16.58,-36.5,;15.67,-37.75,;16.29,-39.16,;17.83,-39.33,;21.54,-42.43,;22.78,-43.33,;22.61,-44.86,;23.85,-45.77,;25.26,-45.15,;26.5,-46.05,;25.42,-43.61,;24.18,-42.71,;16.29,-43.83,;14.78,-44.14,)|	InChI=1S/C31H39ClN4O2/c1-33-23-11-7-21(8-12-23)20-36-26-6-4-3-5-25(26)29-30(36)28(38-24-13-9-22(32)10-14-24)19-27(31(29)37)35-17-15-34(2)16-18-35/h3-6,9-10,13-14,21,23,27-28,33H,7-8,11-12,15-20H2,1-2H3	PBHGXPVLHMQKRM-UHFFFAOYSA-N	50422856	CHEMBL205261	Neuropeptide Y receptor type 1	Homo sapiens		 93							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422856	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422856&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409340	164151731		CHEMBL205261					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034163	CN1CCN(CC1)[C@@H]1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2CC1CCNCC1	InChI=1S/C29H35ClN4O2/c1-32-14-16-33(17-15-32)25-18-26(36-22-8-6-21(30)7-9-22)28-27(29(25)35)23-4-2-3-5-24(23)34(28)19-20-10-12-31-13-11-20/h2-9,20,25-26,31H,10-19H2,1H3	JJJYHZWMXCJWRV-UHFFFAOYSA-N	50422857	CHEMBL206723	Neuropeptide Y receptor type 1	Homo sapiens		 776							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422857	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422857&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409363	164151732		CHEMBL206723					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51034164	CC1CCN(CC1)[C@H]1C[C@@H](Oc2ccc(Cl)cc2)c2c(C1=O)c1ccccc1n2CC1CCNCC1	InChI=1S/C30H36ClN3O2/c1-20-12-16-33(17-13-20)26-18-27(36-23-8-6-22(31)7-9-23)29-28(30(26)35)24-4-2-3-5-25(24)34(29)19-21-10-14-32-15-11-21/h2-9,20-21,26-27,32H,10-19H2,1H3	FLJLGJKLCGQKKZ-UHFFFAOYSA-N	50422858	CHEMBL382836	Neuropeptide Y receptor type 1	Homo sapiens		 22							ChEMBL	10.1016/j.bmcl.2005.11.104	10.7270/Q2WW7JZG	16364642			Di Fabio, R; Giovannini, R; Bertani, B; Borriello, M; Bozzoli, A; Donati, D; Falchi, A; Ghirlanda, D; Leslie, CP; Pecunioso, A; Rumboldt, G; Spada, S	2/7/2006	9/23/2013	Glaxosmithkline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50422858	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50422858&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search			44409121	164151733		CHEMBL382836					1	MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI	7VGX,8K6M,8K6O,5ZBH	Neuropeptide Y receptor type 1	NPY1R_HUMAN	P25929	B2R6H5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
