BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50314226	Clc1cccc(NC(=O)N(C2CCN(CC2)C2CCCC2)c2ccc(cc2)-c2cccc(c2)C#N)c1	InChI=1S/C30H31ClN4O/c31-25-7-4-8-26(20-25)33-30(36)35(29-15-17-34(18-16-29)27-9-1-2-10-27)28-13-11-23(12-14-28)24-6-3-5-22(19-24)21-32/h3-8,11-14,19-20,27,29H,1-2,9-10,15-18H2,(H,33,36)	NPHUHIPVCQOVTH-UHFFFAOYSA-N	50170608	3-(3-Chloro-phenyl)-1-(3'-cyano-biphenyl-4-yl)-1-(1-cyclopentyl-piperidin-4-yl)-urea::CHEMBL187721	Melanin-concentrating hormone receptor 1	Homo sapiens	 5.8								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170608	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170608&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11420621	104056988		CHEMBL187721					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314227	CC(C)C(=O)N1CCC(CC1)N(C(=O)Nc1ccc(F)c(c1)C(F)(F)F)c1ccc(cc1)-c1cccc(c1)C#N	InChI=1S/C30H28F4N4O2/c1-19(2)28(39)37-14-12-25(13-15-37)38(29(40)36-23-8-11-27(31)26(17-23)30(32,33)34)24-9-6-21(7-10-24)22-5-3-4-20(16-22)18-35/h3-11,16-17,19,25H,12-15H2,1-2H3,(H,36,40)	XXTVDGZANMNIOX-UHFFFAOYSA-N	50170610	1-(3'-Cyano-biphenyl-4-yl)-3-(4-fluoro-3-trifluoromethyl-phenyl)-1-(1-isobutyryl-piperidin-4-yl)-urea::CHEMBL186156	Melanin-concentrating hormone receptor 1	Homo sapiens	 374.0								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170610	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170610&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11786179	104056990		CHEMBL186156					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314228	O[C@@H]1CCN(CCN(C(=O)Nc2cc(Cl)cc(Cl)c2)c2ccc(cc2)-c2cccc(c2)C#N)C1	InChI=1S/C26H24Cl2N4O2/c27-21-13-22(28)15-23(14-21)30-26(34)32(11-10-31-9-8-25(33)17-31)24-6-4-19(5-7-24)20-3-1-2-18(12-20)16-29/h1-7,12-15,25,33H,8-11,17H2,(H,30,34)	FRBQAYOFCSWUEW-UHFFFAOYSA-N	50170611	1-(3'-Cyano-biphenyl-4-yl)-3-(3,4-dichloro-phenyl)-1-[2-((R)-3-hydroxy-pyrrolidin-1-yl)-ethyl]-urea::CHEMBL189029	Melanin-concentrating hormone receptor 1	Homo sapiens	 11								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170611	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170611&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11420543	104056991		CHEMBL189029					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314229	FC(F)(F)c1cccc(c1)-c1ccc(cc1)N(C1CCN(CC1)C1CCCC1)C(=O)Nc1cc(Cl)cc(Cl)c1	InChI=1S/C30H30Cl2F3N3O/c31-23-17-24(32)19-25(18-23)36-29(39)38(28-12-14-37(15-13-28)26-6-1-2-7-26)27-10-8-20(9-11-27)21-4-3-5-22(16-21)30(33,34)35/h3-5,8-11,16-19,26,28H,1-2,6-7,12-15H2,(H,36,39)	QOTHFQDQDBUSQQ-UHFFFAOYSA-N	50170609	1-(1-Cyclopentyl-piperidin-4-yl)-3-(3,4-dichloro-phenyl)-1-(3'-trifluoromethyl-biphenyl-4-yl)-urea::CHEMBL363459	Melanin-concentrating hormone receptor 1	Homo sapiens	 197								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170609	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170609&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11387603	104056989		CHEMBL363459					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314230	CN(C)CCN(C(=O)Nc1cc(Cl)cc(Cl)c1)c1ccc(cc1)-c1cccc(c1)C#N	InChI=1S/C24H22Cl2N4O/c1-29(2)10-11-30(24(31)28-22-14-20(25)13-21(26)15-22)23-8-6-18(7-9-23)19-5-3-4-17(12-19)16-27/h3-9,12-15H,10-11H2,1-2H3,(H,28,31)	DIYGGJYYKNHEOP-UHFFFAOYSA-N	50170612	1-(3'-Cyano-biphenyl-4-yl)-3-(3,4-dichloro-phenyl)-1-(2-dimethylamino-ethyl)-urea::CHEMBL191390	Melanin-concentrating hormone receptor 1	Homo sapiens	 19								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170612	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170612&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11247985	104056992		CHEMBL191390					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314231	Fc1cc(NC(=O)N(CCN2CCCC2)c2ccc(cc2)-c2cccc(c2)C#N)ccc1C(F)(F)F	InChI=1S/C27H24F4N4O/c28-25-17-22(8-11-24(25)27(29,30)31)33-26(36)35(15-14-34-12-1-2-13-34)23-9-6-20(7-10-23)21-5-3-4-19(16-21)18-32/h3-11,16-17H,1-2,12-15H2,(H,33,36)	XEZTZOZLTARYHV-UHFFFAOYSA-N	50170613	1-(3'-Cyano-biphenyl-4-yl)-3-(3-fluoro-4-trifluoromethyl-phenyl)-1-(2-pyrrolidin-1-yl-ethyl)-urea::CHEMBL190780	Melanin-concentrating hormone receptor 1	Homo sapiens	 5.6								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170613	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170613&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11752320	104056993		CHEMBL190780					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314232	Fc1ccc(NC(=O)N(C2CCN(CC2)C2CCCC2)c2ccc(cc2)-c2cccc(c2)C#N)cc1C(F)(F)F	InChI=1S/C31H30F4N4O/c32-29-13-10-24(19-28(29)31(33,34)35)37-30(40)39(27-14-16-38(17-15-27)25-6-1-2-7-25)26-11-8-22(9-12-26)23-5-3-4-21(18-23)20-36/h3-5,8-13,18-19,25,27H,1-2,6-7,14-17H2,(H,37,40)	FNSISEJWJOQAKZ-UHFFFAOYSA-N	50170614	1-(3'-Cyano-biphenyl-4-yl)-1-(1-cyclopentyl-piperidin-4-yl)-3-(4-fluoro-3-trifluoromethyl-phenyl)-urea::CHEMBL363044	Melanin-concentrating hormone receptor 1	Homo sapiens	 1.9								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170614	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170614&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11168831	104056994		CHEMBL363044					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314233	CNCCN(C(=O)Nc1ccc(F)c(Cl)c1)c1ccc(cc1)-c1cccc(c1)C#N	InChI=1S/C23H20ClFN4O/c1-27-11-12-29(23(30)28-19-7-10-22(25)21(24)14-19)20-8-5-17(6-9-20)18-4-2-3-16(13-18)15-26/h2-10,13-14,27H,11-12H2,1H3,(H,28,30)	OSTMRUJPPBVRRB-UHFFFAOYSA-N	50170615	3-(3-Chloro-4-fluoro-phenyl)-1-(3'-cyano-biphenyl-4-yl)-1-(2-methylamino-ethyl)-urea::CHEMBL189611	Melanin-concentrating hormone receptor 1	Homo sapiens	 6								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170615	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170615&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11452967	104056995		CHEMBL189611					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314234	O[C@@H]1CCN(CCN(C(=O)Nc2ccc(F)c(Cl)c2)c2ccc(cc2)-c2cccc(c2)C#N)C1	InChI=1S/C26H24ClFN4O2/c27-24-15-21(6-9-25(24)28)30-26(34)32(13-12-31-11-10-23(33)17-31)22-7-4-19(5-8-22)20-3-1-2-18(14-20)16-29/h1-9,14-15,23,33H,10-13,17H2,(H,30,34)	WOXBARSAGMGXSF-UHFFFAOYSA-N	50170616	3-(3-Chloro-4-fluoro-phenyl)-1-(3'-cyano-biphenyl-4-yl)-1-[2-((R)-3-hydroxy-pyrrolidin-1-yl)-ethyl]-urea::CHEMBL191078	Melanin-concentrating hormone receptor 1	Homo sapiens	 7.1								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170616	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170616&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11420203	104056996		CHEMBL191078					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314235	Clc1cc(Cl)cc(NC(=O)N(C2CCN(CC2)C2CCCC2)c2ccc(cc2)-c2cccc(c2)C#N)c1	InChI=1S/C30H30Cl2N4O/c31-24-17-25(32)19-26(18-24)34-30(37)36(29-12-14-35(15-13-29)27-6-1-2-7-27)28-10-8-22(9-11-28)23-5-3-4-21(16-23)20-33/h3-5,8-11,16-19,27,29H,1-2,6-7,12-15H2,(H,34,37)	VPUOHMLGGDPCGX-UHFFFAOYSA-N	50170617	1-(3'-cyano-biphenyl-4-yl)-1-(1-cyclopentyl-piperidin-4-yl)-3-(3,5-dichloro-phenyl)-urea::CHEMBL364871	Melanin-concentrating hormone receptor 1	Homo sapiens	 2.6								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170617	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170617&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			10165503	104056997		CHEMBL364871					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314236	O[C@@H]1CCN(CCN(C(=O)Nc2ccc(F)c(c2)C(F)(F)F)c2ccc(cc2)-c2cccc(c2)C#N)C1	InChI=1S/C27H24F4N4O2/c28-25-9-6-21(15-24(25)27(29,30)31)33-26(37)35(13-12-34-11-10-23(36)17-34)22-7-4-19(5-8-22)20-3-1-2-18(14-20)16-32/h1-9,14-15,23,36H,10-13,17H2,(H,33,37)	HQHBDTOJHLOXRD-UHFFFAOYSA-N	50164243	(R)-1-(3'-cyanobiphenyl-4-yl)-3-(4-fluoro-3-(trifluoromethyl)phenyl)-1-(2-(3-hydroxypyrrolidin-1-yl)ethyl)urea::1-(3'-Cyano-biphenyl-4-yl)-3-(4-fluoro-3-trifluoromethyl-phenyl)-1-[2-((R)-3-hydroxy-pyrrolidin-1-yl)-ethyl]-urea::CHEMBL191393	Melanin-concentrating hormone receptor 1	Homo sapiens	 1.8								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50164243	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50164243&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11168186	104050098		CHEMBL191393					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314237	CN(C)CCN(C(=O)Nc1ccc(c(F)c1)C(F)(F)F)c1ccc(cc1)-c1cccc(c1)C#N	InChI=1S/C25H22F4N4O/c1-32(2)12-13-33(24(34)31-20-8-11-22(23(26)15-20)25(27,28)29)21-9-6-18(7-10-21)19-5-3-4-17(14-19)16-30/h3-11,14-15H,12-13H2,1-2H3,(H,31,34)	VKXZYKTWMWDCGS-UHFFFAOYSA-N	50170618	1-(3'-Cyano-biphenyl-4-yl)-1-(2-dimethylamino-ethyl)-3-(3-fluoro-4-trifluoromethyl-phenyl)-urea::CHEMBL190401	Melanin-concentrating hormone receptor 1	Homo sapiens	 6								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170618	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170618&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			10140070	104056998		CHEMBL190401					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314238	Clc1cccc(c1)-c1ccc(cc1)N(C1CCN(CC1)C1CCCC1)C(=O)Nc1cc(Cl)cc(Cl)c1	InChI=1S/C29H30Cl3N3O/c30-22-5-3-4-21(16-22)20-8-10-27(11-9-20)35(29(36)33-25-18-23(31)17-24(32)19-25)28-12-14-34(15-13-28)26-6-1-2-7-26/h3-5,8-11,16-19,26,28H,1-2,6-7,12-15H2,(H,33,36)	ILWJAUZBOBRMBD-UHFFFAOYSA-N	50170619	1-(3'-Chloro-biphenyl-4-yl)-1-(1-cyclopentyl-piperidin-4-yl)-3-(3,4-dichloro-phenyl)-urea::CHEMBL433591	Melanin-concentrating hormone receptor 1	Homo sapiens	 12.5								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170619	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170619&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11295707	104056999		CHEMBL433591					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314239	O[C@H]1CCN(CCN(C(=O)Nc2ccc(c(F)c2)C(F)(F)F)c2ccc(cc2)-c2cccc(c2)C#N)C1	InChI=1S/C27H24F4N4O2/c28-25-15-21(6-9-24(25)27(29,30)31)33-26(37)35(13-12-34-11-10-23(36)17-34)22-7-4-19(5-8-22)20-3-1-2-18(14-20)16-32/h1-9,14-15,23,36H,10-13,17H2,(H,33,37)	GWJDUOBMDIOPJP-UHFFFAOYSA-N	50170620	1-(3'-Cyano-biphenyl-4-yl)-3-(3-fluoro-4-trifluoromethyl-phenyl)-1-[2-((S)-3-hydroxy-pyrrolidin-1-yl)-ethyl]-urea::CHEMBL187931	Melanin-concentrating hormone receptor 1	Homo sapiens	 7.3								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170620	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170620&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11156521	104057000		CHEMBL187931					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314240	COc1ccc(NC(=O)N(C2CCN(CC2)C2CCCC2)c2ccc(cc2)-c2cccc(c2)C#N)cc1	InChI=1S/C31H34N4O2/c1-37-30-15-11-26(12-16-30)33-31(36)35(29-17-19-34(20-18-29)27-7-2-3-8-27)28-13-9-24(10-14-28)25-6-4-5-23(21-25)22-32/h4-6,9-16,21,27,29H,2-3,7-8,17-20H2,1H3,(H,33,36)	ASHROHBPVCQVJV-UHFFFAOYSA-N	50170623	1-(3'-Cyano-biphenyl-4-yl)-1-(1-cyclopentyl-piperidin-4-yl)-3-(4-methoxy-phenyl)-urea::CHEMBL371809	Melanin-concentrating hormone receptor 1	Homo sapiens	 139								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170623	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170623&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11340894	104057003		CHEMBL371809					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314241	COc1cccc(NC(=O)N(C2CCN(CC2)C2CCCC2)c2ccc(cc2)-c2cccc(c2)C#N)c1	InChI=1S/C31H34N4O2/c1-37-30-11-5-8-26(21-30)33-31(36)35(29-16-18-34(19-17-29)27-9-2-3-10-27)28-14-12-24(13-15-28)25-7-4-6-23(20-25)22-32/h4-8,11-15,20-21,27,29H,2-3,9-10,16-19H2,1H3,(H,33,36)	RBIGRMCAQTZPPB-UHFFFAOYSA-N	50170621	1-(3'-Cyano-biphenyl-4-yl)-1-(1-cyclopentyl-piperidin-4-yl)-3-(3-methoxy-phenyl)-urea::CHEMBL187719	Melanin-concentrating hormone receptor 1	Homo sapiens	 98								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170621	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170621&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11306487	104057001		CHEMBL187719					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314242	CN(C)CCN(C(=O)Nc1ccc(F)c(Cl)c1)c1ccc(cc1)-c1cccc(c1)C#N	InChI=1S/C24H22ClFN4O/c1-29(2)12-13-30(24(31)28-20-8-11-23(26)22(25)15-20)21-9-6-18(7-10-21)19-5-3-4-17(14-19)16-27/h3-11,14-15H,12-13H2,1-2H3,(H,28,31)	TWIOADNIUSVZGY-UHFFFAOYSA-N	50170622	3-(3-Chloro-4-fluoro-phenyl)-1-(3'-cyano-biphenyl-4-yl)-1-(2-dimethylamino-ethyl)-urea::CHEMBL189147	Melanin-concentrating hormone receptor 1	Homo sapiens	 3.3								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170622	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170622&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			10203421	104057002		CHEMBL189147					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314243	Fc1ccc(NC(=O)N(C2CCN(CC2)C2CCCC2)c2ccc(cc2)-c2cccc(c2)C#N)cc1Cl	InChI=1S/C30H30ClFN4O/c31-28-19-24(10-13-29(28)32)34-30(37)36(27-14-16-35(17-15-27)25-6-1-2-7-25)26-11-8-22(9-12-26)23-5-3-4-21(18-23)20-33/h3-5,8-13,18-19,25,27H,1-2,6-7,14-17H2,(H,34,37)	NFZSAMALEWHITI-UHFFFAOYSA-N	50170625	3-(3-Chloro-4-fluoro-phenyl)-1-(3'-cyano-biphenyl-4-yl)-1-(1-cyclopentyl-piperidin-4-yl)-urea::CHEMBL364162	Melanin-concentrating hormone receptor 1	Homo sapiens	 1.6								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170625	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170625&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			10301472	104057005		CHEMBL364162					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314244	CN1CCN(CCN(C(=O)Nc2ccc(c(F)c2)C(F)(F)F)c2ccc(cc2)-c2cccc(c2)C#N)CC1	InChI=1S/C28H27F4N5O/c1-35-11-13-36(14-12-35)15-16-37(27(38)34-23-7-10-25(26(29)18-23)28(30,31)32)24-8-5-21(6-9-24)22-4-2-3-20(17-22)19-33/h2-10,17-18H,11-16H2,1H3,(H,34,38)	WZTUZQBTOLXMEM-UHFFFAOYSA-N	50170624	1-(3'-Cyano-biphenyl-4-yl)-3-(3-fluoro-4-trifluoromethyl-phenyl)-1-[2-(4-methyl-piperazin-1-yl)-ethyl]-urea::CHEMBL187996	Sodium-dependent serotonin transporter	Rattus norvegicus	>1000								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170624	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2253&target=Sodium-dependent+serotonin+transporter&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170624&enzyme=Sodium-dependent+serotonin+transporter&column=ki&startPg=0&Increment=50&submit=Search			11260997	104057004		CHEMBL187996					1	METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEASHSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIIAWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIHQSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGATLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLTLTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLISTPGTLKERIIKSITPETPTEIPCGDIRMNAV	7MGW,7LI7,6DZV	Sodium-dependent serotonin transporter	SC6A4_RAT	P31652	P23976																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314245	Fc1ccc(NC(=O)N(C2CCN(CC3CC3)CC2)c2ccc(cc2)-c2cccc(c2)C#N)cc1C(F)(F)F	InChI=1S/C30H28F4N4O/c31-28-11-8-24(17-27(28)30(32,33)34)36-29(39)38(26-12-14-37(15-13-26)19-20-4-5-20)25-9-6-22(7-10-25)23-3-1-2-21(16-23)18-35/h1-3,6-11,16-17,20,26H,4-5,12-15,19H2,(H,36,39)	GRQMCEOLOUOYLX-UHFFFAOYSA-N	50170626	1-(3'-Cyano-biphenyl-4-yl)-1-(1-cyclopropylmethyl-piperidin-4-yl)-3-(4-fluoro-3-trifluoromethyl-phenyl)-urea::CHEMBL191409	Melanin-concentrating hormone receptor 1	Homo sapiens	 4								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170626	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170626&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11376081	104057006		CHEMBL191409					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314246	FC(F)(F)Oc1cccc(c1)-c1ccc(cc1)N(C1CCN(CC1)C1CCCC1)C(=O)Nc1cc(Cl)cc(Cl)c1	InChI=1S/C30H30Cl2F3N3O2/c31-22-17-23(32)19-24(18-22)36-29(39)38(27-12-14-37(15-13-27)25-5-1-2-6-25)26-10-8-20(9-11-26)21-4-3-7-28(16-21)40-30(33,34)35/h3-4,7-11,16-19,25,27H,1-2,5-6,12-15H2,(H,36,39)	XGIADJVYGMKVCJ-UHFFFAOYSA-N	50170627	1-(1-Cyclopentyl-piperidin-4-yl)-3-(3,4-dichloro-phenyl)-1-(3'-trifluoromethoxy-biphenyl-4-yl)-urea::CHEMBL190219	Melanin-concentrating hormone receptor 1	Homo sapiens	 20								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170627	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170627&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11238695	104057007		CHEMBL190219					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314247	O[C@@H]1CCN(CCN(C(=O)Nc2ccc(c(F)c2)C(F)(F)F)c2ccc(cc2)-c2cccc(c2)C#N)C1	InChI=1S/C27H24F4N4O2/c28-25-15-21(6-9-24(25)27(29,30)31)33-26(37)35(13-12-34-11-10-23(36)17-34)22-7-4-19(5-8-22)20-3-1-2-18(14-20)16-32/h1-9,14-15,23,36H,10-13,17H2,(H,33,37)	GWJDUOBMDIOPJP-UHFFFAOYSA-N	50170628	1-(3'-Cyano-biphenyl-4-yl)-3-(3-fluoro-4-trifluoromethyl-phenyl)-1-[2-((R)-3-hydroxy-pyrrolidin-1-yl)-ethyl]-urea::CHEMBL433596	Melanin-concentrating hormone receptor 1	Homo sapiens	 8.9								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170628	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170628&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11489130	104057008		CHEMBL433596					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314248	CN1CCN(CCN(C(=O)Nc2ccc(c(F)c2)C(F)(F)F)c2ccc(cc2)-c2cccc(c2)C#N)CC1	InChI=1S/C28H27F4N5O/c1-35-11-13-36(14-12-35)15-16-37(27(38)34-23-7-10-25(26(29)18-23)28(30,31)32)24-8-5-21(6-9-24)22-4-2-3-20(17-22)19-33/h2-10,17-18H,11-16H2,1H3,(H,34,38)	WZTUZQBTOLXMEM-UHFFFAOYSA-N	50170624	1-(3'-Cyano-biphenyl-4-yl)-3-(3-fluoro-4-trifluoromethyl-phenyl)-1-[2-(4-methyl-piperazin-1-yl)-ethyl]-urea::CHEMBL187996	Melanin-concentrating hormone receptor 1	Homo sapiens	 8.2								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170624	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170624&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11260997	104057004		CHEMBL187996					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314249	CCN1CCC(CC1)N(C(=O)Nc1ccc(F)c(c1)C(F)(F)F)c1ccc(cc1)-c1cccc(c1)C#N	InChI=1S/C28H26F4N4O/c1-2-35-14-12-24(13-15-35)36(27(37)34-22-8-11-26(29)25(17-22)28(30,31)32)23-9-6-20(7-10-23)21-5-3-4-19(16-21)18-33/h3-11,16-17,24H,2,12-15H2,1H3,(H,34,37)	IOLHPSAVXRSYSY-UHFFFAOYSA-N	50170630	1-(3'-Cyano-biphenyl-4-yl)-1-(1-ethyl-piperidin-4-yl)-3-(4-fluoro-3-trifluoromethyl-phenyl)-urea::CHEMBL191079	Melanin-concentrating hormone receptor 1	Homo sapiens	 7.1								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170630	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170630&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11752579	104057010		CHEMBL191079					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314250	O=C(Nc1ccccc1)N(C1CCN(CC1)C1CCCC1)c1ccc(cc1)-c1cccc(c1)C#N	InChI=1S/C30H32N4O/c31-22-23-7-6-8-25(21-23)24-13-15-28(16-14-24)34(30(35)32-26-9-2-1-3-10-26)29-17-19-33(20-18-29)27-11-4-5-12-27/h1-3,6-10,13-16,21,27,29H,4-5,11-12,17-20H2,(H,32,35)	UCYFFDSDPSZAET-UHFFFAOYSA-N	50170629	1-(3'-Cyano-biphenyl-4-yl)-1-(1-cyclopentyl-piperidin-4-yl)-3-phenyl-urea::CHEMBL188088	Melanin-concentrating hormone receptor 1	Homo sapiens	 233								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170629	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170629&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11282697	104057009		CHEMBL188088					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314251	CN(C)CCN(C(=O)Nc1ccc(F)c(Cl)c1)c1ccc(cc1)-c1cccc(c1)C#N	InChI=1S/C24H22ClFN4O/c1-29(2)12-13-30(24(31)28-20-8-11-23(26)22(25)15-20)21-9-6-18(7-10-21)19-5-3-4-17(14-19)16-27/h3-11,14-15H,12-13H2,1-2H3,(H,28,31)	TWIOADNIUSVZGY-UHFFFAOYSA-N	50170622	3-(3-Chloro-4-fluoro-phenyl)-1-(3'-cyano-biphenyl-4-yl)-1-(2-dimethylamino-ethyl)-urea::CHEMBL189147	Sodium-dependent serotonin transporter	Rattus norvegicus	 1076								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170622	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2253&target=Sodium-dependent+serotonin+transporter&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170622&enzyme=Sodium-dependent+serotonin+transporter&column=ki&startPg=0&Increment=50&submit=Search			10203421	104057002		CHEMBL189147					1	METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEASHSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIIAWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIHQSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGATLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLTLTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLISTPGTLKERIIKSITPETPTEIPCGDIRMNAV	7MGW,7LI7,6DZV	Sodium-dependent serotonin transporter	SC6A4_RAT	P31652	P23976																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50314252	CCS(=O)(=O)N1CCC(CC1)N(C(=O)Nc1ccc(F)c(c1)C(F)(F)F)c1ccc(cc1)-c1cccc(c1)C#N	InChI=1S/C28H26F4N4O3S/c1-2-40(38,39)35-14-12-24(13-15-35)36(27(37)34-22-8-11-26(29)25(17-22)28(30,31)32)23-9-6-20(7-10-23)21-5-3-4-19(16-21)18-33/h3-11,16-17,24H,2,12-15H2,1H3,(H,34,37)	WFVZFFRTFPTZNM-UHFFFAOYSA-N	50170631	1-(3'-Cyano-biphenyl-4-yl)-1-(1-ethanesulfonyl-piperidin-4-yl)-3-(4-fluoro-3-trifluoromethyl-phenyl)-urea::CHEMBL187942	Melanin-concentrating hormone receptor 1	Homo sapiens	 166								ChEMBL	10.1021/jm0503852	10.7270/Q2P55N26	16033253			Palani, A; Shapiro, S; McBriar, MD; Clader, JW; Greenlee, WJ; Spar, B; Kowalski, TJ; Farley, C; Cook, J; van Heek, M; Weig, B; O'neill, K; Graziano, M; Hawes, B	7/21/2005	11/10/2009	Schering-Plough Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170631	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170631&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			11786476	104057011		CHEMBL187942					1	MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT	8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH	Melanin-concentrating hormone receptor 1	MCHR1_HUMAN	Q99705	B2RBX6 Q5R3J1 Q96S47 Q9BV08																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
