BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50313764 CN(C)C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cc1 InChI=1S/C25H27N3O/c1-27(2)24-16-17-28(18-24)23-14-12-22(13-15-23)26-25(29)21-10-8-20(9-11-21)19-6-4-3-5-7-19/h3-15,24H,16-18H2,1-2H3,(H,26,29) LJZCBRBAZOERPC-UHFFFAOYSA-N 50170390 Biphenyl-4-carboxylic acid [4-(3-dimethylamino-pyrrolidin-1-yl)-phenyl]-amide::CHEMBL176142 Melanin-concentrating hormone receptor 1 Homo sapiens 5.2 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170390 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170390&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388227 104056781 CHEMBL176142 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313765 CN(C)C1CCN(C1)c1ccc(NC(=O)C#Cc2ccccc2)cc1 InChI=1S/C21H23N3O/c1-23(2)20-14-15-24(16-20)19-11-9-18(10-12-19)22-21(25)13-8-17-6-4-3-5-7-17/h3-7,9-12,20H,14-16H2,1-2H3,(H,22,25) RGPASQKSEJIRKR-UHFFFAOYSA-N 50170391 3-Phenyl-propynoic acid [4-(3-dimethylamino-pyrrolidin-1-yl)-phenyl]-amide::CHEMBL360996 Melanin-concentrating hormone receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170391 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170391&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388280 104056782 CHEMBL360996 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313766 CN(C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cc1)C(C)=O InChI=1S/C26H27N3O2/c1-19(30)28(2)25-16-17-29(18-25)24-14-12-23(13-15-24)27-26(31)22-10-8-21(9-11-22)20-6-4-3-5-7-20/h3-15,25H,16-18H2,1-2H3,(H,27,31) RMWMPXWLDCTYLQ-UHFFFAOYSA-N 50170392 Biphenyl-4-carboxylic acid {4-[3-(acetyl-methyl-amino)-pyrrolidin-1-yl]-phenyl}-amide::CHEMBL179974 Melanin-concentrating hormone receptor 1 Homo sapiens 3000 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170392 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170392&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388451 104056783 CHEMBL179974 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313767 CN(Cc1ccccn1)C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cc1 InChI=1S/C30H30N4O/c1-33(21-27-9-5-6-19-31-27)29-18-20-34(22-29)28-16-14-26(15-17-28)32-30(35)25-12-10-24(11-13-25)23-7-3-2-4-8-23/h2-17,19,29H,18,20-22H2,1H3,(H,32,35) JWXCLECDJCIPAS-UHFFFAOYSA-N 50170393 Biphenyl-4-carboxylic acid {4-[3-(methyl-pyridin-2-ylmethyl-amino)-pyrrolidin-1-yl]-phenyl}-amide::CHEMBL179417 Melanin-concentrating hormone receptor 1 Homo sapiens 130 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170393 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170393&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388427 104056784 CHEMBL179417 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313768 CN(C)C1CCN(C1)c1ccc(NC(=O)c2ccc(Oc3ccccc3)cc2)cc1 InChI=1S/C25H27N3O2/c1-27(2)22-16-17-28(18-22)21-12-10-20(11-13-21)26-25(29)19-8-14-24(15-9-19)30-23-6-4-3-5-7-23/h3-15,22H,16-18H2,1-2H3,(H,26,29) AAPDSPGBQMKWII-UHFFFAOYSA-N 50170394 N-[4-(3-Dimethylamino-pyrrolidin-1-yl)-phenyl]-4-phenoxy-benzamide::CHEMBL179870 Melanin-concentrating hormone receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170394 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170394&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388308 104056785 CHEMBL179870 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313769 CNC1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cn1 InChI=1S/C23H24N4O/c1-24-21-13-14-27(16-21)22-12-11-20(15-25-22)26-23(28)19-9-7-18(8-10-19)17-5-3-2-4-6-17/h2-12,15,21,24H,13-14,16H2,1H3,(H,26,28) DOKSQMPMAHUKLJ-UHFFFAOYSA-N 50170395 Biphenyl-4-carboxylic acid [6-(3-methylamino-pyrrolidin-1-yl)-pyridin-3-yl]-amide::CHEMBL425518 Melanin-concentrating hormone receptor 1 Homo sapiens 61 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170395 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170395&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 11610423 104056786 CHEMBL425518 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313770 CNC1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cn1 InChI=1S/C23H24N4O/c1-24-21-13-14-27(16-21)22-12-11-20(15-25-22)26-23(28)19-9-7-18(8-10-19)17-5-3-2-4-6-17/h2-12,15,21,24H,13-14,16H2,1H3,(H,26,28) DOKSQMPMAHUKLJ-UHFFFAOYSA-N 50170395 Biphenyl-4-carboxylic acid [6-(3-methylamino-pyrrolidin-1-yl)-pyridin-3-yl]-amide::CHEMBL425518 Melanin-concentrating hormone receptor 1 Homo sapiens 122 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170395 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170395&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 11610423 104056786 CHEMBL425518 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313771 CN(C)C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2cnco2)cc1 InChI=1S/C22H24N4O2/c1-25(2)20-11-12-26(14-20)19-9-7-18(8-10-19)24-22(27)17-5-3-16(4-6-17)21-13-23-15-28-21/h3-10,13,15,20H,11-12,14H2,1-2H3,(H,24,27) PWDIPKVAEZYAIB-UHFFFAOYSA-N 50170397 N-[4-(3-Dimethylamino-pyrrolidin-1-yl)-phenyl]-4-oxazol-5-yl-benzamide::CHEMBL359707 Melanin-concentrating hormone receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170397 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170397&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388380 104056788 CHEMBL359707 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313772 CN(C)C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-n2ccnc2)cc1 InChI=1S/C22H25N5O/c1-25(2)21-11-13-26(15-21)19-9-5-18(6-10-19)24-22(28)17-3-7-20(8-4-17)27-14-12-23-16-27/h3-10,12,14,16,21H,11,13,15H2,1-2H3,(H,24,28) XKHZEEWTGCJUDR-UHFFFAOYSA-N 50170396 N-[4-(3-Dimethylamino-pyrrolidin-1-yl)-phenyl]-4-imidazol-1-yl-benzamide::CHEMBL175675 Melanin-concentrating hormone receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170396 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170396&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388345 104056787 CHEMBL175675 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313773 CN(C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cc1)C(=O)OC(C)(C)C InChI=1S/C29H33N3O3/c1-29(2,3)35-28(34)31(4)26-18-19-32(20-26)25-16-14-24(15-17-25)30-27(33)23-12-10-22(11-13-23)21-8-6-5-7-9-21/h5-17,26H,18-20H2,1-4H3,(H,30,33) HITQVUQEBFHHBI-UHFFFAOYSA-N 50170398 (1-{4-[(Biphenyl-4-carbonyl)-amino]-phenyl}-pyrrolidin-3-yl)-methyl-carbamic acid tert-butyl ester::CHEMBL176092 Melanin-concentrating hormone receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170398 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170398&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388395 104056789 CHEMBL176092 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313774 CN(C)C1CCN(C1)c1ccc(NC(=O)NCCCc2ccccc2)cc1 InChI=1S/C22H30N4O/c1-25(2)21-14-16-26(17-21)20-12-10-19(11-13-20)24-22(27)23-15-6-9-18-7-4-3-5-8-18/h3-5,7-8,10-13,21H,6,9,14-17H2,1-2H3,(H2,23,24,27) MKWGPLWTVPTPPD-UHFFFAOYSA-N 50170399 1-[4-(3-Dimethylamino-pyrrolidin-1-yl)-phenyl]-3-(3-phenyl-propyl)-urea::CHEMBL178772 Melanin-concentrating hormone receptor 1 Homo sapiens 43 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170399 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170399&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388311 104056790 CHEMBL178772 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313775 CCN(C)C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cc1 InChI=1S/C26H29N3O/c1-3-28(2)25-17-18-29(19-25)24-15-13-23(14-16-24)27-26(30)22-11-9-21(10-12-22)20-7-5-4-6-8-20/h4-16,25H,3,17-19H2,1-2H3,(H,27,30) QTTNTRWBJMKECS-UHFFFAOYSA-N 50170400 Biphenyl-4-carboxylic acid {4-[3-(ethyl-methyl-amino)-pyrrolidin-1-yl]-phenyl}-amide::CHEMBL179072 Melanin-concentrating hormone receptor 1 Homo sapiens 5.9 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170400 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170400&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388417 104056791 CHEMBL179072 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313776 CN(C)C1CCN(C1)c1ccc(NC(=O)C2CCC(CC2)c2ccc(Cl)cc2)cc1 |(10.24,-3.22,;10.39,-1.69,;11.79,-1.05,;9.13,-.79,;9.12,.75,;7.65,1.21,;6.77,-.05,;7.68,-1.28,;5.23,-.05,;4.44,1.28,;2.9,1.25,;2.13,-.08,;.59,-.09,;-.18,1.24,;.59,2.58,;-1.72,1.24,;-2.49,-.1,;-4.03,-.1,;-4.8,1.23,;-4.03,2.57,;-2.49,2.57,;-6.34,1.23,;-7.11,-.1,;-8.63,-.12,;-9.42,1.23,;-10.96,1.23,;-8.65,2.56,;-7.11,2.56,;2.92,-1.41,;4.46,-1.41,)| InChI=1S/C25H32ClN3O/c1-28(2)24-15-16-29(17-24)23-13-11-22(12-14-23)27-25(30)20-5-3-18(4-6-20)19-7-9-21(26)10-8-19/h7-14,18,20,24H,3-6,15-17H2,1-2H3,(H,27,30) XNTXJPSLNHPCDJ-UHFFFAOYSA-N 50170401 4-(4-Chloro-phenyl)-cyclohexanecarboxylic acid [4-(3-dimethylamino-pyrrolidin-1-yl)-phenyl]-amide::CHEMBL179260 Melanin-concentrating hormone receptor 1 Homo sapiens 12 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170401 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170401&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388293 104056792 CHEMBL179260 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313777 CN(C)C1CCN(C1)c1ccc(NC(=O)C2CCC(CC2)c2ccccc2)cc1 |(10.24,-3.22,;10.39,-1.69,;11.79,-1.05,;9.13,-.79,;9.12,.75,;7.65,1.21,;6.77,-.05,;7.68,-1.28,;5.23,-.05,;4.46,-1.41,;2.92,-1.41,;2.13,-.08,;.59,-.09,;-.18,1.24,;.59,2.58,;-1.72,1.24,;-2.49,2.57,;-4.03,2.57,;-4.8,1.23,;-4.03,-.1,;-2.49,-.1,;-6.34,1.23,;-7.11,-.1,;-8.63,-.12,;-9.42,1.23,;-8.65,2.56,;-7.11,2.56,;2.9,1.25,;4.44,1.28,)| InChI=1S/C25H33N3O/c1-27(2)24-16-17-28(18-24)23-14-12-22(13-15-23)26-25(29)21-10-8-20(9-11-21)19-6-4-3-5-7-19/h3-7,12-15,20-21,24H,8-11,16-18H2,1-2H3,(H,26,29) RJEBAGFMVDKWBZ-UHFFFAOYSA-N 50170402 4-Phenyl-cyclohexanecarboxylic acid [4-(3-dimethylamino-pyrrolidin-1-yl)-phenyl]-amide::CHEMBL180364 Melanin-concentrating hormone receptor 1 Homo sapiens 14 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170402 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170402&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388294 104056793 CHEMBL180364 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313778 CN(C)C1CCN(C1)c1ccc(NC(=O)c2ccc3-c4ccccc4C(=O)c3c2)cc1 InChI=1S/C26H25N3O2/c1-28(2)20-13-14-29(16-20)19-10-8-18(9-11-19)27-26(31)17-7-12-22-21-5-3-4-6-23(21)25(30)24(22)15-17/h3-12,15,20H,13-14,16H2,1-2H3,(H,27,31) HLIYKYSYTAZOKU-UHFFFAOYSA-N 50170403 9-Oxo-9H-fluorene-2-carboxylic acid [4-(3-dimethylamino-pyrrolidin-1-yl)-phenyl]-amide::CHEMBL179013 Melanin-concentrating hormone receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170403 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170403&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388273 104056794 CHEMBL179013 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313779 COc1ccc(CCCNC(=O)Nc2ccc(cc2)N2CCC(C2)N(C)C)cc1 InChI=1S/C23H32N4O2/c1-26(2)21-14-16-27(17-21)20-10-8-19(9-11-20)25-23(28)24-15-4-5-18-6-12-22(29-3)13-7-18/h6-13,21H,4-5,14-17H2,1-3H3,(H2,24,25,28) KZFNMSFWULODNO-UHFFFAOYSA-N 50170405 1-[4-(3-Dimethylamino-pyrrolidin-1-yl)-phenyl]-3-[3-(4-methoxy-phenyl)-propyl]-urea::CHEMBL368228 Melanin-concentrating hormone receptor 1 Homo sapiens 52 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170405 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170405&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388314 104056796 CHEMBL368228 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313780 CN(CCCc1ccccc1)C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cc1 InChI=1S/C33H35N3O/c1-35(23-8-11-26-9-4-2-5-10-26)32-22-24-36(25-32)31-20-18-30(19-21-31)34-33(37)29-16-14-28(15-17-29)27-12-6-3-7-13-27/h2-7,9-10,12-21,32H,8,11,22-25H2,1H3,(H,34,37) FMIDMTMUTLQHNN-UHFFFAOYSA-N 50170404 Biphenyl-4-carboxylic acid (4-{3-[methyl-(3-phenyl-propyl)-amino]-pyrrolidin-1-yl}-phenyl)-amide::CHEMBL361139 Melanin-concentrating hormone receptor 1 Homo sapiens 8.6 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170404 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170404&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388442 104056795 CHEMBL361139 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313781 CN(C)C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2cccs2)cc1 InChI=1S/C23H25N3OS/c1-25(2)21-13-14-26(16-21)20-11-9-19(10-12-20)24-23(27)18-7-5-17(6-8-18)22-4-3-15-28-22/h3-12,15,21H,13-14,16H2,1-2H3,(H,24,27) HWUVUDSVXXNMRO-UHFFFAOYSA-N 50170407 N-[4-(3-Dimethylamino-pyrrolidin-1-yl)-phenyl]-4-thiophen-2-yl-benzamide::CHEMBL178864 Melanin-concentrating hormone receptor 1 Homo sapiens 34 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170407 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170407&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388365 104056798 CHEMBL178864 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313782 COc1ccc(cc1)-c1ccc(cn1)C(=O)Nc1ccc(cc1)N1CCC(C1)N(C)C InChI=1S/C25H28N4O2/c1-28(2)22-14-15-29(17-22)21-9-7-20(8-10-21)27-25(30)19-6-13-24(26-16-19)18-4-11-23(31-3)12-5-18/h4-13,16,22H,14-15,17H2,1-3H3,(H,27,30) QVPVPTUAGMFXHF-UHFFFAOYSA-N 50170408 N-[4-(3-Dimethylamino-pyrrolidin-1-yl)-phenyl]-6-(4-methoxy-phenyl)-nicotinamide::CHEMBL178250 Melanin-concentrating hormone receptor 1 Homo sapiens 16 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170408 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170408&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388303 104056799 CHEMBL178250 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313783 CN(C)C1CCN(C1)c1ccc(NC(=O)CCCC(=O)c2ccc(Cl)cc2)cc1 InChI=1S/C23H28ClN3O2/c1-26(2)21-14-15-27(16-21)20-12-10-19(11-13-20)25-23(29)5-3-4-22(28)17-6-8-18(24)9-7-17/h6-13,21H,3-5,14-16H2,1-2H3,(H,25,29) IBWPEMBCMSWKSH-UHFFFAOYSA-N 50170406 5-(4-Chloro-phenyl)-5-oxo-pentanoic acid [4-(3-dimethylamino-pyrrolidin-1-yl)-phenyl]-amide::CHEMBL178882 Melanin-concentrating hormone receptor 1 Homo sapiens 13 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170406 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170406&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388289 104056797 CHEMBL178882 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313784 CN(C)C1CCN(C1)c1ccc(NC(=O)Cc2ccc(cc2)-c2ccccc2)cc1 InChI=1S/C26H29N3O/c1-28(2)25-16-17-29(19-25)24-14-12-23(13-15-24)27-26(30)18-20-8-10-22(11-9-20)21-6-4-3-5-7-21/h3-15,25H,16-19H2,1-2H3,(H,27,30) PBFAAFXCIXVYJS-UHFFFAOYSA-N 50170410 2-Biphenyl-4-yl-N-[4-(3-dimethylamino-pyrrolidin-1-yl)-phenyl]-acetamide::CHEMBL361423 Melanin-concentrating hormone receptor 1 Homo sapiens 4300 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170410 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170410&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388309 104056801 CHEMBL361423 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313785 CN(C)C1CCN(C1)c1ccc(NC(=O)CCCC(=O)c2ccccc2)cc1 InChI=1S/C23H29N3O2/c1-25(2)21-15-16-26(17-21)20-13-11-19(12-14-20)24-23(28)10-6-9-22(27)18-7-4-3-5-8-18/h3-5,7-8,11-14,21H,6,9-10,15-17H2,1-2H3,(H,24,28) KCZSICBFMKTYFE-UHFFFAOYSA-N 50170409 5-Oxo-5-phenyl-pentanoic acid [4-(3-dimethylamino-pyrrolidin-1-yl)-phenyl]-amide::CHEMBL360567 Melanin-concentrating hormone receptor 1 Homo sapiens 250 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170409 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170409&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388265 104056800 CHEMBL360567 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313786 CNC1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cc1 InChI=1S/C24H25N3O/c1-25-22-15-16-27(17-22)23-13-11-21(12-14-23)26-24(28)20-9-7-19(8-10-20)18-5-3-2-4-6-18/h2-14,22,25H,15-17H2,1H3,(H,26,28) LBHJZTQANJXNGX-UHFFFAOYSA-N 50170411 Biphenyl-4-carboxylic acid [4-(3-methylamino-pyrrolidin-1-yl)-phenyl]-amide::CHEMBL426777 Melanin-concentrating hormone receptor 1 Homo sapiens 3.1 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170411 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170411&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388409 104056802 CHEMBL426777 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313787 CNC1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cn1 InChI=1S/C23H24N4O/c1-24-21-13-14-27(16-21)22-12-11-20(15-25-22)26-23(28)19-9-7-18(8-10-19)17-5-3-2-4-6-17/h2-12,15,21,24H,13-14,16H2,1H3,(H,26,28) DOKSQMPMAHUKLJ-UHFFFAOYSA-N 50170395 Biphenyl-4-carboxylic acid [6-(3-methylamino-pyrrolidin-1-yl)-pyridin-3-yl]-amide::CHEMBL425518 Melanin-concentrating hormone receptor 1 Homo sapiens 2.3 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170395 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170395&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 11610423 104056786 CHEMBL425518 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313788 CN(C)C1CCN(C1)c1ccc(NC(=O)c2ccc(nc2)-c2ccccc2)cc1 InChI=1S/C24H26N4O/c1-27(2)22-14-15-28(17-22)21-11-9-20(10-12-21)26-24(29)19-8-13-23(25-16-19)18-6-4-3-5-7-18/h3-13,16,22H,14-15,17H2,1-2H3,(H,26,29) RMUJYXNEWDVEQS-UHFFFAOYSA-N 50170412 N-[4-(3-Dimethylamino-pyrrolidin-1-yl)-phenyl]-6-phenyl-nicotinamide::CHEMBL179345 Melanin-concentrating hormone receptor 1 Homo sapiens 110 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170412 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170412&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388277 104056803 CHEMBL179345 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313789 CN(CC1CC1)C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cc1 InChI=1S/C28H31N3O/c1-30(19-21-7-8-21)27-17-18-31(20-27)26-15-13-25(14-16-26)29-28(32)24-11-9-23(10-12-24)22-5-3-2-4-6-22/h2-6,9-16,21,27H,7-8,17-20H2,1H3,(H,29,32) HTQACYPZPIQVHN-UHFFFAOYSA-N 50170413 Biphenyl-4-carboxylic acid {4-[3-(cyclopropylmethyl-methyl-amino)-pyrrolidin-1-yl]-phenyl}-amide::CHEMBL179346 Melanin-concentrating hormone receptor 1 Homo sapiens 5.5 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170413 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170413&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388428 104056804 CHEMBL179346 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313790 CN(C)C1CCN(C1)c1ccc(NC(=O)c2ccc(nc2)N2CCCCC2)cc1 InChI=1S/C23H31N5O/c1-26(2)21-12-15-28(17-21)20-9-7-19(8-10-20)25-23(29)18-6-11-22(24-16-18)27-13-4-3-5-14-27/h6-11,16,21H,3-5,12-15,17H2,1-2H3,(H,25,29) YOKINRLTTWCELM-UHFFFAOYSA-N 50170416 3,4,5,6-Tetrahydro-2H-[1,2']bipyridinyl-5'-carboxylic acid [4-(3-dimethylamino-pyrrolidin-1-yl)-phenyl]-amide::CHEMBL178546 Melanin-concentrating hormone receptor 1 Homo sapiens 2400 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170416 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170416&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388355 104056807 CHEMBL178546 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313791 CCN1CCN(CC1)c1ccc(cn1)C(=O)Nc1ccc(cc1)N1CCC(C1)N(C)C InChI=1S/C24H34N6O/c1-4-28-13-15-29(16-14-28)23-10-5-19(17-25-23)24(31)26-20-6-8-21(9-7-20)30-12-11-22(18-30)27(2)3/h5-10,17,22H,4,11-16,18H2,1-3H3,(H,26,31) VOCZQOJNNCOMKZ-UHFFFAOYSA-N 50170414 N-[4-(3-Dimethylamino-pyrrolidin-1-yl)-phenyl]-6-(4-ethyl-piperazin-1-yl)-nicotinamide::CHEMBL178731 Melanin-concentrating hormone receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170414 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170414&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388368 104056805 CHEMBL178731 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313792 CN(Cc1ccccc1)C1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cc1 InChI=1S/C31H31N3O/c1-33(22-24-8-4-2-5-9-24)30-20-21-34(23-30)29-18-16-28(17-19-29)32-31(35)27-14-12-26(13-15-27)25-10-6-3-7-11-25/h2-19,30H,20-23H2,1H3,(H,32,35) SCTNRJAHTZFGPS-UHFFFAOYSA-N 50170415 Biphenyl-4-carboxylic acid {4-[3-(benzyl-methyl-amino)-pyrrolidin-1-yl]-phenyl}-amide::CHEMBL178755 Melanin-concentrating hormone receptor 1 Homo sapiens 31 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170415 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170415&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388425 104056806 CHEMBL178755 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 50313793 CNC1CCN(C1)c1ccc(NC(=O)c2ccc(cc2)-c2ccccc2)cc1 InChI=1S/C24H25N3O/c1-25-22-15-16-27(17-22)23-13-11-21(12-14-23)26-24(28)20-9-7-19(8-10-20)18-5-3-2-4-6-18/h2-14,22,25H,15-17H2,1H3,(H,26,28) LBHJZTQANJXNGX-UHFFFAOYSA-N 50170411 Biphenyl-4-carboxylic acid [4-(3-methylamino-pyrrolidin-1-yl)-phenyl]-amide::CHEMBL426777 Melanin-concentrating hormone receptor 1 Homo sapiens 166 ChEMBL 10.1016/j.bmcl.2005.05.130 10.7270/Q29W0F16 16005225 Huang, CQ; Baker, T; Schwarz, D; Fan, J; Heise, CE; Zhang, M; Goodfellow, VS; Markison, S; Gogas, KR; Chen, T; Wang, XC; Zhu, YF 7/25/2005 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50170411 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3662&target=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50170411&enzyme=Melanin-concentrating+hormone+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44388409 104056802 CHEMBL426777 1 MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT 8WWN,8WWM,8WWL,8WWK,8WWJ,8WWI,8WWH Melanin-concentrating hormone receptor 1 MCHR1_HUMAN Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08