BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50065447 OC(=O)c1cccc(c1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO3S2/c19-15-14(9-11-5-2-1-3-6-11)23-17(22)18(15)13-8-4-7-12(10-13)16(20)21/h1-10H,(H,20,21) ZXNFVGYFPHSNJJ-UHFFFAOYSA-N 50168876 3-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL183967 Dual specificity protein phosphatase 22 Homo sapiens 7000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168876&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 1201219 104053811 CHEMBL183967 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50065449 OC(=O)c1cccc(c1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO3S2/c19-15-14(9-11-5-2-1-3-6-11)23-17(22)18(15)13-8-4-7-12(10-13)16(20)21/h1-10H,(H,20,21) ZXNFVGYFPHSNJJ-UHFFFAOYSA-N 50168876 3-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL183967 Dual specificity protein phosphatase 3 Homo sapiens >100000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168876&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 1201219 104053811 CHEMBL183967 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311353 CC\C=C1/SC(=S)N(C1=O)c1cccc(c1)C(O)=O InChI=1S/C13H11NO3S2/c1-2-4-10-11(15)14(13(18)19-10)9-6-3-5-8(7-9)12(16)17/h3-7H,2H2,1H3,(H,16,17) NUJAOLKIYZDFDT-UHFFFAOYSA-N 50168873 3-[4-Oxo-5-prop-(Z)-ylidene-2-thioxo-thiazolidin-3-yl]-benzoic acid::CHEMBL359646 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168873 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168873&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 44393906 104053808 CHEMBL359646 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311354 OC(=O)c1cccc(c1)N1C(=S)S\C(=C/c2ccc(F)cc2)C1=O InChI=1S/C17H10FNO3S2/c18-12-6-4-10(5-7-12)8-14-15(20)19(17(23)24-14)13-3-1-2-11(9-13)16(21)22/h1-9H,(H,21,22) KZPMAUJRJISOLI-UHFFFAOYSA-N 50168874 3-{5-[1-(4-Fluoro-phenyl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL365871 Dual specificity protein phosphatase 22 Homo sapiens 1300 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168874 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168874&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 1712792 104053809 CHEMBL365871 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311355 Cc1ccc(\C=C2/SC(=S)N(C2=O)c2cccc(c2)C(O)=O)cc1 InChI=1S/C18H13NO3S2/c1-11-5-7-12(8-6-11)9-15-16(20)19(18(23)24-15)14-4-2-3-13(10-14)17(21)22/h2-10H,1H3,(H,21,22) ZEZLEPSGWNNZAS-UHFFFAOYSA-N 50168875 3-{4-Oxo-2-thioxo-5-[1-p-tolyl-meth-(Z)-ylidene]-thiazolidin-3-yl}-benzoic acid::CHEMBL184718 Dual specificity protein phosphatase 22 Homo sapiens 16000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168875 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168875&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 5855015 104053810 CHEMBL184718 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311356 OC(=O)c1cc(ccc1O)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO4S2/c19-13-7-6-11(9-12(13)16(21)22)18-15(20)14(24-17(18)23)8-10-4-2-1-3-5-10/h1-9,19H,(H,21,22) ALOWOXQYWBKLAG-UHFFFAOYSA-N 50168877 2-Hydroxy-5-{4-oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL185578 Dual specificity protein phosphatase 3 Homo sapiens 130000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168877 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168877&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 27431909 104053812 CHEMBL185578 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311357 Cc1ccc(\C=C2/SC(=S)N(C2=O)c2cccc(c2)C(O)=O)cc1 InChI=1S/C18H13NO3S2/c1-11-5-7-12(8-6-11)9-15-16(20)19(18(23)24-15)14-4-2-3-13(10-14)17(21)22/h2-10H,1H3,(H,21,22) ZEZLEPSGWNNZAS-UHFFFAOYSA-N 50168875 3-{4-Oxo-2-thioxo-5-[1-p-tolyl-meth-(Z)-ylidene]-thiazolidin-3-yl}-benzoic acid::CHEMBL184718 Dual specificity protein phosphatase 3 Homo sapiens 123000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168875 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168875&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 5855015 104053810 CHEMBL184718 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311358 OC(=O)c1cccc(c1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO3S2/c19-15-14(9-11-5-2-1-3-6-11)23-17(22)18(15)13-8-4-7-12(10-13)16(20)21/h1-10H,(H,20,21) ZXNFVGYFPHSNJJ-UHFFFAOYSA-N 50168876 3-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL183967 Dual specificity protein phosphatase 3 Homo sapiens >100000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168876&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 1201219 104053811 CHEMBL183967 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311359 OC(=O)Cc1cccc(c1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C18H13NO3S2/c20-16(21)11-13-7-4-8-14(9-13)19-17(22)15(24-18(19)23)10-12-5-2-1-3-6-12/h1-10H,11H2,(H,20,21) YNOIKPKDAHSZJK-UHFFFAOYSA-N 50168878 (3-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-phenyl)-acetic acid::CHEMBL182214 Dual specificity protein phosphatase 22 Homo sapiens 20000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168878&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44393084 104053813 CHEMBL182214 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311360 O=C1N(C(=S)S\C1=C/c1ccccc1)c1ccccc1 InChI=1S/C16H11NOS2/c18-15-14(11-12-7-3-1-4-8-12)20-16(19)17(15)13-9-5-2-6-10-13/h1-11H TZPSGDWUSVAMNF-UHFFFAOYSA-N 50168879 3-Phenyl-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-4-one::CHEMBL360926 Dual specificity protein phosphatase 22 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168879 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168879&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 2302277 104053814 CHEMBL360926 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311361 OC(=O)c1ccc(cc1)N1C(=S)O\C(=C/c2ccc(F)cc2)C1=O InChI=1S/C17H10FNO4S/c18-12-5-1-10(2-6-12)9-14-15(20)19(17(24)23-14)13-7-3-11(4-8-13)16(21)22/h1-9H,(H,21,22) POGCGYWYFNFPKG-UHFFFAOYSA-N 50168880 4-{5-[1-(4-Fluoro-phenyl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-oxazolidin-3-yl}-benzoic acid::CHEMBL183255 Dual specificity protein phosphatase 22 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168880 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168880&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44394885 104053815 CHEMBL183255 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311362 OC(=O)c1ccc(cc1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO3S2/c19-15-14(10-11-4-2-1-3-5-11)23-17(22)18(15)13-8-6-12(7-9-13)16(20)21/h1-10H,(H,20,21) HJGHAHOKZBWVGK-UHFFFAOYSA-N 50168881 4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL185320 Dual specificity protein phosphatase 22 Homo sapiens 18000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168881 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168881&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 1565747 104053816 CHEMBL185320 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311363 OC(=O)c1cccc(c1)N1C(=S)S\C(=C/c2ccc(F)cc2)C1=O InChI=1S/C17H10FNO3S2/c18-12-6-4-10(5-7-12)8-14-15(20)19(17(23)24-14)13-3-1-2-11(9-13)16(21)22/h1-9H,(H,21,22) KZPMAUJRJISOLI-UHFFFAOYSA-N 50168874 3-{5-[1-(4-Fluoro-phenyl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL365871 Dual specificity protein phosphatase 3 Homo sapiens >50000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168874 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168874&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 1712792 104053809 CHEMBL365871 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311364 OC(=O)c1ccc(cc1O)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO4S2/c19-13-9-11(6-7-12(13)16(21)22)18-15(20)14(24-17(18)23)8-10-4-2-1-3-5-10/h1-9,19H,(H,21,22) VKVSAHNJRYXWEW-UHFFFAOYSA-N 50168882 2-Hydroxy-4-{4-oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL185051 Dual specificity protein phosphatase 3 Homo sapiens 45000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168882 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168882&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 27431789 104053817 CHEMBL185051 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311365 OC(=O)Cc1ccc(cc1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C18H13NO3S2/c20-16(21)11-13-6-8-14(9-7-13)19-17(22)15(24-18(19)23)10-12-4-2-1-3-5-12/h1-10H,11H2,(H,20,21) IADLPMMOHYUQOB-UHFFFAOYSA-N 50168883 (4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-phenyl)-acetic acid::CHEMBL360380 Dual specificity protein phosphatase 3 Homo sapiens 100000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168883&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 18839120 104053818 CHEMBL360380 C03768 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311366 CN1C(=S)N(C(=O)\C1=C\c1ccc(F)cc1)c1ccc(cc1)C(O)=O InChI=1S/C18H13FN2O3S/c1-20-15(10-11-2-6-13(19)7-3-11)16(22)21(18(20)25)14-8-4-12(5-9-14)17(23)24/h2-10H,1H3,(H,23,24) UFKFKQYESQIERK-UHFFFAOYSA-N 50168884 4-{4-[1-(4-Fluoro-phenyl)-meth-(Z)-ylidene]-3-methyl-5-oxo-2-thioxo-imidazolidin-1-yl}-benzoic acid::CHEMBL186853 Dual specificity protein phosphatase 22 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168884 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168884&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44394674 104053819 CHEMBL186853 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311367 OC(=O)c1cc(ccc1O)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO4S2/c19-13-7-6-11(9-12(13)16(21)22)18-15(20)14(24-17(18)23)8-10-4-2-1-3-5-10/h1-9,19H,(H,21,22) ALOWOXQYWBKLAG-UHFFFAOYSA-N 50168877 2-Hydroxy-5-{4-oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL185578 Dual specificity protein phosphatase 22 Homo sapiens 13000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168877 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168877&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 27431909 104053812 CHEMBL185578 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311368 OC(=O)c1cccc(c1)-n1c([O-])c([CH+]c2ccc(cc2)[N+]([O-])=O)sc1=S InChI=1S/C17H10N2O5S2/c20-15-14(8-10-4-6-12(7-5-10)19(23)24)26-17(25)18(15)13-3-1-2-11(9-13)16(21)22/h1-9H,(H-,20,21,22) JYRLRXGROPBBNI-UHFFFAOYSA-N 50168885 3-{5-[1-(4-Nitro-phenyl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL435096 Dual specificity protein phosphatase 22 Homo sapiens 2600 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168885 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168885&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 1641724 104053820 CHEMBL435096 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311369 OS(=O)(=O)c1ccc(cc1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C16H11NO4S3/c18-15-14(10-11-4-2-1-3-5-11)23-16(22)17(15)12-6-8-13(9-7-12)24(19,20)21/h1-10H,(H,19,20,21) KPRDEYZQDGJCRJ-UHFFFAOYSA-N 50168886 4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzenesulfonic acid::CHEMBL182343 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168886 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168886&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 44393800 104053821 CHEMBL182343 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311371 OC(=O)Cc1cccc(c1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C18H13NO3S2/c20-16(21)11-13-7-4-8-14(9-13)19-17(22)15(24-18(19)23)10-12-5-2-1-3-6-12/h1-10H,11H2,(H,20,21) YNOIKPKDAHSZJK-UHFFFAOYSA-N 50168878 (3-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-phenyl)-acetic acid::CHEMBL182214 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168878&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 44393084 104053813 CHEMBL182214 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311372 OC(=O)c1ccc(CN2C(=S)S\C(=C/c3ccccc3)C2=O)cc1 InChI=1S/C18H13NO3S2/c20-16-15(10-12-4-2-1-3-5-12)24-18(23)19(16)11-13-6-8-14(9-7-13)17(21)22/h1-10H,11H2,(H,21,22) QLTPQALISSOLCM-UHFFFAOYSA-N 50168887 4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-ylmethyl}-benzoic acid::CHEMBL362391 Dual specificity protein phosphatase 22 Homo sapiens 60000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168887 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168887&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44393159 104053822 CHEMBL362391 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311373 Cc1cc(ccc1N1C(=S)S\C(=C/c2ccccc2)C1=O)C(O)=O InChI=1S/C18H13NO3S2/c1-11-9-13(17(21)22)7-8-14(11)19-16(20)15(24-18(19)23)10-12-5-3-2-4-6-12/h2-10H,1H3,(H,21,22) PNYSVFQLTUWDBQ-UHFFFAOYSA-N 50168889 3-Methyl-4-{4-oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL182865 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168889 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168889&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 44393378 104053824 CHEMBL182865 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311374 OC(=O)c1cccc(c1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO3S2/c19-15-14(9-11-5-2-1-3-6-11)23-17(22)18(15)13-8-4-7-12(10-13)16(20)21/h1-10H,(H,20,21) ZXNFVGYFPHSNJJ-UHFFFAOYSA-N 50168876 3-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL183967 Dual specificity protein phosphatase 22 Homo sapiens 7000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168876&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 1201219 104053811 CHEMBL183967 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311375 OC(=O)c1cc(cc(c1)C(O)=O)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C18H11NO5S2/c20-15-14(6-10-4-2-1-3-5-10)26-18(25)19(15)13-8-11(16(21)22)7-12(9-13)17(23)24/h1-9H,(H,21,22)(H,23,24) ILWIYZXRGGLJQP-UHFFFAOYSA-N 50168888 5-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-isophthalic acid::CHEMBL184939 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168888 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168888&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 18841331 104053823 CHEMBL184939 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311376 OC(=O)c1ccc(cc1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO3S2/c19-15-14(10-11-4-2-1-3-5-11)23-17(22)18(15)13-8-6-12(7-9-13)16(20)21/h1-10H,(H,20,21) HJGHAHOKZBWVGK-UHFFFAOYSA-N 50168881 4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL185320 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168881 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168881&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 1565747 104053816 CHEMBL185320 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311377 CC\C=C1/SC(=S)N(C1=O)c1cccc(c1)C(O)=O InChI=1S/C13H11NO3S2/c1-2-4-10-11(15)14(13(18)19-10)9-6-3-5-8(7-9)12(16)17/h3-7H,2H2,1H3,(H,16,17) NUJAOLKIYZDFDT-UHFFFAOYSA-N 50168873 3-[4-Oxo-5-prop-(Z)-ylidene-2-thioxo-thiazolidin-3-yl]-benzoic acid::CHEMBL359646 Dual specificity protein phosphatase 22 Homo sapiens 59000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168873 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168873&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44393906 104053808 CHEMBL359646 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311378 OC(=O)c1ccccc1N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO3S2/c19-15-14(10-11-6-2-1-3-7-11)23-17(22)18(15)13-9-5-4-8-12(13)16(20)21/h1-10H,(H,20,21) OEJOLXCMYQOIMZ-UHFFFAOYSA-N 50168890 2-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL184552 Dual specificity protein phosphatase 22 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168890 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168890&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44393364 104053825 CHEMBL184552 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311379 OC(=O)c1cc(cc(c1)C(O)=O)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C18H11NO5S2/c20-15-14(6-10-4-2-1-3-5-10)26-18(25)19(15)13-8-11(16(21)22)7-12(9-13)17(23)24/h1-9H,(H,21,22)(H,23,24) ILWIYZXRGGLJQP-UHFFFAOYSA-N 50168888 5-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-isophthalic acid::CHEMBL184939 Dual specificity protein phosphatase 22 Homo sapiens 103000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168888 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168888&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 18841331 104053823 CHEMBL184939 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311380 Cc1cc(ccc1N1C(=S)S\C(=C/c2ccccc2)C1=O)C(O)=O InChI=1S/C18H13NO3S2/c1-11-9-13(17(21)22)7-8-14(11)19-16(20)15(24-18(19)23)10-12-5-3-2-4-6-12/h2-10H,1H3,(H,21,22) PNYSVFQLTUWDBQ-UHFFFAOYSA-N 50168889 3-Methyl-4-{4-oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL182865 Dual specificity protein phosphatase 22 Homo sapiens 66000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168889 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168889&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44393378 104053824 CHEMBL182865 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311381 COC(=O)c1ccc(cc1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C18H13NO3S2/c1-22-17(21)13-7-9-14(10-8-13)19-16(20)15(24-18(19)23)11-12-5-3-2-4-6-12/h2-11H,1H3 VCWVGKBLNQZBND-UHFFFAOYSA-N 50168892 4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid methyl ester::CHEMBL362045 Dual specificity protein phosphatase 22 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168892&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44393353 104053827 CHEMBL362045 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311382 OC(=O)c1ccc(CN2C(=S)S\C(=C/c3ccccc3)C2=O)cc1 InChI=1S/C18H13NO3S2/c20-16-15(10-12-4-2-1-3-5-12)24-18(23)19(16)11-13-6-8-14(9-7-13)17(21)22/h1-10H,11H2,(H,21,22) QLTPQALISSOLCM-UHFFFAOYSA-N 50168887 4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-ylmethyl}-benzoic acid::CHEMBL362391 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168887 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168887&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 44393159 104053822 CHEMBL362391 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311383 OS(=O)(=O)c1ccc(cc1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C16H11NO4S3/c18-15-14(10-11-4-2-1-3-5-11)23-16(22)17(15)12-6-8-13(9-7-12)24(19,20)21/h1-10H,(H,19,20,21) KPRDEYZQDGJCRJ-UHFFFAOYSA-N 50168886 4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzenesulfonic acid::CHEMBL182343 Dual specificity protein phosphatase 22 Homo sapiens 11000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168886 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168886&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44393800 104053821 CHEMBL182343 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311384 OC(=O)c1ccc(cc1)N1C(=S)NC(=Cc2ccc(F)cc2)C1=O |w:14.15| InChI=1S/C17H11FN2O3S/c18-12-5-1-10(2-6-12)9-14-15(21)20(17(24)19-14)13-7-3-11(4-8-13)16(22)23/h1-9H,(H,19,24)(H,22,23) WXRVNKAVFXSDDL-UHFFFAOYSA-N 50168891 4-{4-[1-(4-Fluoro-phenyl)-meth-(Z)-ylidene]-5-oxo-2-thioxo-imidazolidin-1-yl}-benzoic acid::CHEMBL184008 Dual specificity protein phosphatase 22 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168891 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168891&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44394181 104053826 CHEMBL184008 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311385 OC(=O)c1ccccc1N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO3S2/c19-15-14(10-11-6-2-1-3-7-11)23-17(22)18(15)13-9-5-4-8-12(13)16(20)21/h1-10H,(H,20,21) OEJOLXCMYQOIMZ-UHFFFAOYSA-N 50168890 2-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL184552 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168890 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168890&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 44393364 104053825 CHEMBL184552 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311386 OC(=O)c1cccc(c1)-n1c([O-])c([CH+]c2ccc(cc2)[N+]([O-])=O)sc1=S InChI=1S/C17H10N2O5S2/c20-15-14(8-10-4-6-12(7-5-10)19(23)24)26-17(25)18(15)13-3-1-2-11(9-13)16(21)22/h1-9H,(H-,20,21,22) JYRLRXGROPBBNI-UHFFFAOYSA-N 50168885 3-{5-[1-(4-Nitro-phenyl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL435096 Dual specificity protein phosphatase 3 Homo sapiens >50000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168885 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168885&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 1641724 104053820 CHEMBL435096 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311387 OC(=O)c1cccc(c1)N1C(=S)S\C(=C/C2CCCCC2)C1=O InChI=1S/C17H17NO3S2/c19-15-14(9-11-5-2-1-3-6-11)23-17(22)18(15)13-8-4-7-12(10-13)16(20)21/h4,7-11H,1-3,5-6H2,(H,20,21) HOADRJRBKTWDSI-UHFFFAOYSA-N 50168893 3-{5-[1-Cyclohexyl-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL360332 Dual specificity protein phosphatase 22 Homo sapiens 7300 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168893 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168893&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44393848 104053828 CHEMBL360332 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311388 OC(=O)c1ccc(cc1O)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C17H11NO4S2/c19-13-9-11(6-7-12(13)16(21)22)18-15(20)14(24-17(18)23)8-10-4-2-1-3-5-10/h1-9,19H,(H,21,22) VKVSAHNJRYXWEW-UHFFFAOYSA-N 50168882 2-Hydroxy-4-{4-oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL185051 Dual specificity protein phosphatase 22 Homo sapiens 13000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168882 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168882&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 27431789 104053817 CHEMBL185051 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311389 OP(O)(=O)Cc1ccc(cc1)N1C(=S)SC(=Cc2ccccc2)C1=O |w:16.17| InChI=1S/C17H14NO4PS2/c19-16-15(10-12-4-2-1-3-5-12)25-17(24)18(16)14-8-6-13(7-9-14)11-23(20,21)22/h1-10H,11H2,(H2,20,21,22) RCIFGHVGDDWFCV-UHFFFAOYSA-N 50168894 (4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzyl)-phosphonic acid::CHEMBL181535 Dual specificity protein phosphatase 22 Homo sapiens 10000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168894 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168894&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44393803 104053829 CHEMBL181535 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311390 COc1ccc(\C=C2/SC(=S)N(C2=O)c2cccc(c2)C(O)=O)cc1 InChI=1S/C18H13NO4S2/c1-23-14-7-5-11(6-8-14)9-15-16(20)19(18(24)25-15)13-4-2-3-12(10-13)17(21)22/h2-10H,1H3,(H,21,22) YODDOVXWAXEELX-UHFFFAOYSA-N 50168897 3-{5-[1-(4-Methoxy-phenyl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL183336 Dual specificity protein phosphatase 22 Homo sapiens 26000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168897 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168897&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 6206321 104053832 CHEMBL183336 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311391 OC(=O)Cc1ccc(cc1)N1C(=S)S\C(=C/c2ccccc2)C1=O InChI=1S/C18H13NO3S2/c20-16(21)11-13-6-8-14(9-7-13)19-17(22)15(24-18(19)23)10-12-4-2-1-3-5-12/h1-10H,11H2,(H,20,21) IADLPMMOHYUQOB-UHFFFAOYSA-N 50168883 (4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-phenyl)-acetic acid::CHEMBL360380 Dual specificity protein phosphatase 22 Homo sapiens 20000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168883&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 18839120 104053818 CHEMBL360380 C03768 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311392 OC(=O)c1ccc(\C=C2/SC(=S)N(C2=O)c2cccc(c2)C(O)=O)cc1 InChI=1S/C18H11NO5S2/c20-15-14(8-10-4-6-11(7-5-10)16(21)22)26-18(25)19(15)13-3-1-2-12(9-13)17(23)24/h1-9H,(H,21,22)(H,23,24) XGSDTADDVLFQKU-UHFFFAOYSA-N 50168895 3-[(5Z)-5-(4-carboxybenzylidene)-4-oxo-2-thioxo-1,3-thiazolidin-3-yl]benzoic acid::CHEMBL185166 Dual specificity protein phosphatase 22 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168895 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168895&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 6531889 104053830 CHEMBL185166 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311393 OP(O)(=O)Cc1ccc(cc1)N1C(=S)SC(=Cc2ccccc2)C1=O |w:16.17| InChI=1S/C17H14NO4PS2/c19-16-15(10-12-4-2-1-3-5-12)25-17(24)18(16)14-8-6-13(7-9-14)11-23(20,21)22/h1-10H,11H2,(H2,20,21,22) RCIFGHVGDDWFCV-UHFFFAOYSA-N 50168894 (4-{4-Oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzyl)-phosphonic acid::CHEMBL181535 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168894 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168894&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 44393803 104053829 CHEMBL181535 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311394 OC(=O)c1cccc(c1)N1C(=S)S\C(=C/c2ccc(O)cc2)C1=O InChI=1S/C17H11NO4S2/c19-13-6-4-10(5-7-13)8-14-15(20)18(17(23)24-14)12-3-1-2-11(9-12)16(21)22/h1-9,19H,(H,21,22) WYYHOPRRRYYUIF-UHFFFAOYSA-N 50168898 3-{5-[1-(4-Hydroxy-phenyl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL185361 Dual specificity protein phosphatase 22 Homo sapiens 157000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168898 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168898&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 6531498 104053833 CHEMBL185361 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311395 OC(=O)c1ccc(cc1)N1C(=S)S\C(=C/c2ccc(F)cc2)C1=O InChI=1S/C17H10FNO3S2/c18-12-5-1-10(2-6-12)9-14-15(20)19(17(23)24-14)13-7-3-11(4-8-13)16(21)22/h1-9H,(H,21,22) SBAWETQNNLKNNE-UHFFFAOYSA-N 50168896 4-{5-[1-(4-Fluoro-phenyl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL185401 Dual specificity protein phosphatase 22 Homo sapiens 4200 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168896 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168896&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 1201069 104053831 CHEMBL185401 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311396 OC(=O)c1ccc(cc1)N1C(=O)S\C(=C/c2ccc(F)cc2)C1=O InChI=1S/C17H10FNO4S/c18-12-5-1-10(2-6-12)9-14-15(20)19(17(23)24-14)13-7-3-11(4-8-13)16(21)22/h1-9H,(H,21,22) CJUXHGFFZYKFMW-UHFFFAOYSA-N 50168899 4-{5-[1-(4-Fluoro-phenyl)-meth-(Z)-ylidene]-2,4-dioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL184363 Dual specificity protein phosphatase 22 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168899 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4975&target=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168899&enzyme=Dual+specificity+protein+phosphatase+22&column=ki&startPg=0&Increment=50&submit=Search 44394712 104053834 CHEMBL184363 1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL 1WRM,6LVQ Dual specificity protein phosphatase 22 DUS22_HUMAN Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1 50311397 OC(=O)c1cccc(c1)N1C(=S)S\C(=C/c2ccc(O)cc2)C1=O InChI=1S/C17H11NO4S2/c19-13-6-4-10(5-7-13)8-14-15(20)18(17(23)24-14)12-3-1-2-11(9-12)16(21)22/h1-9,19H,(H,21,22) WYYHOPRRRYYUIF-UHFFFAOYSA-N 50168898 3-{5-[1-(4-Hydroxy-phenyl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL185361 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168898 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168898&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 6531498 104053833 CHEMBL185361 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311398 OC(=O)c1cccc(c1)N1C(=S)S\C(=C/C2CCCCC2)C1=O InChI=1S/C17H17NO3S2/c19-15-14(9-11-5-2-1-3-6-11)23-17(22)18(15)13-8-4-7-12(10-13)16(20)21/h4,7-11H,1-3,5-6H2,(H,20,21) HOADRJRBKTWDSI-UHFFFAOYSA-N 50168893 3-{5-[1-Cyclohexyl-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL360332 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168893 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168893&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 44393848 104053828 CHEMBL360332 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311400 COc1ccc(\C=C2/SC(=S)N(C2=O)c2cccc(c2)C(O)=O)cc1 InChI=1S/C18H13NO4S2/c1-23-14-7-5-11(6-8-14)9-15-16(20)19(18(24)25-15)13-4-2-3-12(10-13)17(21)22/h2-10H,1H3,(H,21,22) YODDOVXWAXEELX-UHFFFAOYSA-N 50168897 3-{5-[1-(4-Methoxy-phenyl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-benzoic acid::CHEMBL183336 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168897 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168897&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 6206321 104053832 CHEMBL183336 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9 50311401 OC(=O)c1ccc(\C=C2/SC(=S)N(C2=O)c2cccc(c2)C(O)=O)cc1 InChI=1S/C18H11NO5S2/c20-15-14(8-10-4-6-11(7-5-10)16(21)22)26-18(25)19(15)13-3-1-2-12(9-13)17(23)24/h1-9H,(H,21,22)(H,23,24) XGSDTADDVLFQKU-UHFFFAOYSA-N 50168895 3-[(5Z)-5-(4-carboxybenzylidene)-4-oxo-2-thioxo-1,3-thiazolidin-3-yl]benzoic acid::CHEMBL185166 Dual specificity protein phosphatase 3 Homo sapiens >200000 ChEMBL 10.1016/j.bmcl.2005.05.034 10.7270/Q2NG4Q4B 15961311 Cutshall, NS; O'Day, C; Prezhdo, M 6/24/2005 11/10/2009 Ceptyr http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50168895 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2953&target=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50168895&enzyme=Dual+specificity+protein+phosphatase+3&column=ki&startPg=0&Increment=50&submit=Search 6531889 104053830 CHEMBL185166 1 MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP 9DJ9,1VHR,8TK6,8TK5,8TK4,8TK3,8TK2,3F81 Dual specificity protein phosphatase 3 DUS3_HUMAN P51452 D3DX45 Q5U0J1 Q8IYJ9