BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
22115	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(N)cc1 |r|	InChI=1S/C33H46N6O5S2/c1-22(2)18-38(46(43,44)28-13-11-26(34)12-14-28)20-30(40)29(17-25-9-7-6-8-10-25)36-32(41)31(23(3)4)39-16-15-37(33(39)42)19-27-21-45-24(5)35-27/h6-14,21-23,29-31,40H,15-20,34H2,1-5H3,(H,36,41)	VDVZBQBZEQDPRQ-UHFFFAOYSA-N	12198	(2S)-N-[(2S,3R)-4-[(4-aminobenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 8	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 31					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12198	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12198&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278357	46509380							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22116	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(NC=O)cc1 |r|	InChI=1S/C34H46N6O6S2/c1-23(2)18-39(48(45,46)29-13-11-27(12-14-29)35-22-41)20-31(42)30(17-26-9-7-6-8-10-26)37-33(43)32(24(3)4)40-16-15-38(34(40)44)19-28-21-47-25(5)36-28/h6-14,21-24,30-32,42H,15-20H2,1-5H3,(H,35,41)(H,37,43)	XKFKANWUGSUPQS-UHFFFAOYSA-N	12199	(2S)-N-[(2S,3R)-4-[(4-formamidobenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 9	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 168					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12199	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12199&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278358	46509381					C06049		1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22117	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(NS(C)(=O)=O)cc1 |r|	InChI=1S/C34H48N6O7S3/c1-23(2)19-39(50(46,47)29-14-12-27(13-15-29)37-49(6,44)45)21-31(41)30(18-26-10-8-7-9-11-26)36-33(42)32(24(3)4)40-17-16-38(34(40)43)20-28-22-48-25(5)35-28/h7-15,22-24,30-32,37,41H,16-21H2,1-6H3,(H,36,42)	JFDGOOVRTCFBJB-UHFFFAOYSA-N	12200	(2S)-N-[(2S,3R)-3-hydroxy-4-[(4-methanesulfonamidobenzene)(2-methylpropyl)sulfonamido]-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 10	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 1190					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12200	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12200&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278359	46509382							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22118	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(NC(C)=O)cc1 |r|	InChI=1S/C35H48N6O6S2/c1-23(2)19-40(49(46,47)30-14-12-28(13-15-30)36-25(5)42)21-32(43)31(18-27-10-8-7-9-11-27)38-34(44)33(24(3)4)41-17-16-39(35(41)45)20-29-22-48-26(6)37-29/h7-15,22-24,31-33,43H,16-21H2,1-6H3,(H,36,42)(H,38,44)	YEVSHOXETFGJQT-UHFFFAOYSA-N	12201	(2S)-N-[(2S,3R)-4-[(4-acetamidobenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 11	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 312					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12201	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12201&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278360	46511510							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22119	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(cc1)C(O)=O |r|	InChI=1S/C34H45N5O7S2/c1-22(2)18-38(48(45,46)28-13-11-26(12-14-28)33(42)43)20-30(40)29(17-25-9-7-6-8-10-25)36-32(41)31(23(3)4)39-16-15-37(34(39)44)19-27-21-47-24(5)35-27/h6-14,21-23,29-31,40H,15-20H2,1-5H3,(H,36,41)(H,42,43)	NIVFLNXJWPPTJH-UHFFFAOYSA-N	12202	4-{[(2R,3S)-2-hydroxy-3-[(2S)-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamido]-4-phenylbutyl](2-methylpropyl)sulfamoyl}benzoic acid::benzenesulfonamide analog 12	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 10000					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12202	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12202&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278361	46509383							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22120	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(cc1)C(C)=O |r|	InChI=1S/C35H47N5O6S2/c1-23(2)19-39(48(45,46)30-14-12-28(13-15-30)25(5)41)21-32(42)31(18-27-10-8-7-9-11-27)37-34(43)33(24(3)4)40-17-16-38(35(40)44)20-29-22-47-26(6)36-29/h7-15,22-24,31-33,42H,16-21H2,1-6H3,(H,37,43)	LENUTIVCGMBJLC-UHFFFAOYSA-N	12203	(2S)-N-[(2S,3R)-4-[(4-acetylbenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 13	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 39					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12203	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12203&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			23645109	46510809							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22121	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(cc1)C#N |r|	InChI=1S/C34H44N6O5S2/c1-23(2)19-39(47(44,45)29-13-11-27(18-35)12-14-29)21-31(41)30(17-26-9-7-6-8-10-26)37-33(42)32(24(3)4)40-16-15-38(34(40)43)20-28-22-46-25(5)36-28/h6-14,22-24,30-32,41H,15-17,19-21H2,1-5H3,(H,37,42)	PFYFUNKDJXVULZ-UHFFFAOYSA-N	12204	(2S)-N-[(2S,3R)-4-[(4-cyanobenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 14	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 148					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12204	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12204&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278363	46509384							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22122	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(cc1)C(N)=O |r|	InChI=1S/C34H46N6O6S2/c1-22(2)18-39(48(45,46)28-13-11-26(12-14-28)32(35)42)20-30(41)29(17-25-9-7-6-8-10-25)37-33(43)31(23(3)4)40-16-15-38(34(40)44)19-27-21-47-24(5)36-27/h6-14,21-23,29-31,41H,15-20H2,1-5H3,(H2,35,42)(H,37,43)	HAAWHYFIWOKEAU-UHFFFAOYSA-N	12205	4-{[(2R,3S)-2-hydroxy-3-[(2S)-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamido]-4-phenylbutyl](2-methylpropyl)sulfamoyl}benzamide::benzenesulfonamide analog 15	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 254					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12205	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12205&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278364	46510810							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22123	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(cc1)C(=N)NO |r|	InChI=1S/C34H47N7O6S2/c1-22(2)18-40(49(46,47)28-13-11-26(12-14-28)32(35)38-45)20-30(42)29(17-25-9-7-6-8-10-25)37-33(43)31(23(3)4)41-16-15-39(34(41)44)19-27-21-48-24(5)36-27/h6-14,21-23,29-31,42,45H,15-20H2,1-5H3,(H2,35,38)(H,37,43)	OTCQJTJPPZIOEV-UHFFFAOYSA-N	12206	(2S)-N-[(2S,3R)-3-hydroxy-4-{[4-(N'-hydroxycarbamimidoyl)benzene](2-methylpropyl)sulfonamido}-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 16	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 143					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12206	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12206&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			23645110	46510811							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22124	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(C=C)cc1 |r|	InChI=1S/C35H47N5O5S2/c1-7-27-13-15-30(16-14-27)47(44,45)39(20-24(2)3)22-32(41)31(19-28-11-9-8-10-12-28)37-34(42)33(25(4)5)40-18-17-38(35(40)43)21-29-23-46-26(6)36-29/h7-16,23-25,31-33,41H,1,17-22H2,2-6H3,(H,37,42)	SJTROPKIQZVOHY-UHFFFAOYSA-N	12207	(2S)-N-[(2S,3R)-4-[(4-ethenylbenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 17	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 101					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12207	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12207&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278366	46511039							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22125	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(C=O)cc1 |r|	InChI=1S/C34H45N5O6S2/c1-23(2)18-38(47(44,45)29-13-11-27(21-40)12-14-29)20-31(41)30(17-26-9-7-6-8-10-26)36-33(42)32(24(3)4)39-16-15-37(34(39)43)19-28-22-46-25(5)35-28/h6-14,21-24,30-32,41H,15-20H2,1-5H3,(H,36,42)	PPRPODQJBNQLSC-UHFFFAOYSA-N	12208	(2S)-N-[(2S,3R)-4-[(4-formylbenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 18	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 51					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12208	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12208&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278367	46509385							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22126	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(CO)cc1 |r|	InChI=1S/C34H47N5O6S2/c1-23(2)18-38(47(44,45)29-13-11-27(21-40)12-14-29)20-31(41)30(17-26-9-7-6-8-10-26)36-33(42)32(24(3)4)39-16-15-37(34(39)43)19-28-22-46-25(5)35-28/h6-14,22-24,30-32,40-41H,15-21H2,1-5H3,(H,36,42)	FQRYWBLGQCRXMV-UHFFFAOYSA-N	12209	(2S)-N-[(2S,3R)-3-hydroxy-4-{[4-(hydroxymethyl)benzene](2-methylpropyl)sulfonamido}-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 19	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 16					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12209	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12209&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278368	46511126							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22127	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1ccc(CN=O)cc1 |r|	InChI=1S/C34H46N6O6S2/c1-23(2)19-39(48(45,46)29-13-11-27(12-14-29)18-35-44)21-31(41)30(17-26-9-7-6-8-10-26)37-33(42)32(24(3)4)40-16-15-38(34(40)43)20-28-22-47-25(5)36-28/h6-14,22-24,30-32,41H,15-21H2,1-5H3,(H,37,42)	IEPCFSOVHNREMM-UHFFFAOYSA-N	12210	(2S)-N-[(2S,3R)-3-hydroxy-4-({4-[(1E)-(hydroxyimino)methyl]benzene}(2-methylpropyl)sulfonamido)-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 20	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 5					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12210	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12210&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			91309448	46511191							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22128	CO\N=C\c1ccc(cc1)S(=O)(=O)N(CC(C)C)C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O |r|	InChI=1S/C35H48N6O6S2/c1-24(2)20-40(49(45,46)30-14-12-28(13-15-30)19-36-47-6)22-32(42)31(18-27-10-8-7-9-11-27)38-34(43)33(25(3)4)41-17-16-39(35(41)44)21-29-23-48-26(5)37-29/h7-15,19,23-25,31-33,42H,16-18,20-22H2,1-6H3,(H,38,43)	XFIFAFLWLSMGAW-UHFFFAOYSA-N	12211	(2S)-N-[(2S,3R)-3-hydroxy-4-({4-[(1E)-(methoxyimino)methyl]benzene}(2-methylpropyl)sulfonamido)-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 21	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 653					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12211	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12211&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			11821078	46511196							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22129	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1cccc(CO)c1 |r|	InChI=1S/C34H47N5O6S2/c1-23(2)18-38(47(44,45)29-13-9-12-27(16-29)21-40)20-31(41)30(17-26-10-7-6-8-11-26)36-33(42)32(24(3)4)39-15-14-37(34(39)43)19-28-22-46-25(5)35-28/h6-13,16,22-24,30-32,40-41H,14-15,17-21H2,1-5H3,(H,36,42)	GOLISNLKXLDRCV-UHFFFAOYSA-N	12212	(2S)-N-[(2S,3R)-3-hydroxy-4-{[3-(hydroxymethyl)benzene](2-methylpropyl)sulfonamido}-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 22	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 45					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12212	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12212&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			5278371	46511292							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22130	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](C(C)C)N1CCN(Cc2csc(C)n2)C1=O)S(=O)(=O)c1cccc(CN=O)c1 |r|	InChI=1S/C34H46N6O6S2/c1-23(2)19-39(48(45,46)29-13-9-12-27(16-29)18-35-44)21-31(41)30(17-26-10-7-6-8-11-26)37-33(42)32(24(3)4)40-15-14-38(34(40)43)20-28-22-47-25(5)36-28/h6-13,16,22-24,30-32,41H,14-15,17-21H2,1-5H3,(H,37,42)	OLGYDWQDBNWYEM-UHFFFAOYSA-N	12213	(2S)-N-[(2S,3R)-3-hydroxy-4-({3-[(1E)-(hydroxyimino)methyl]benzene}(2-methylpropyl)sulfonamido)-1-phenylbutan-2-yl]-3-methyl-2-{3-[(2-methyl-1,3-thiazol-4-yl)methyl]-2-oxoimidazolidin-1-yl}butanamide::benzenesulfonamide analog 23	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 16					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=12213	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=12213&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			91895865	46511307							1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22131	CC(C)[C@H](N1CCCNC1=O)C(=O)N[C@H](C[C@H](O)[C@H](Cc1ccccc1)NC(=O)COc1c(C)cccc1C)Cc1ccccc1 |r|	InChI=1S/C37H48N4O5/c1-25(2)34(41-20-12-19-38-37(41)45)36(44)39-30(21-28-15-7-5-8-16-28)23-32(42)31(22-29-17-9-6-10-18-29)40-33(43)24-46-35-26(3)13-11-14-27(35)4/h5-11,13-18,25,30-32,34,42H,12,19-24H2,1-4H3,(H,38,45)(H,39,44)(H,40,43)	KJHKTHWMRKYKJE-UHFFFAOYSA-N	578	(2S)-N-[(2S,4S,5S)-5-[2-(2,6-dimethylphenoxy)acetamido]-4-hydroxy-1,6-diphenylhexan-2-yl]-3-methyl-2-(2-oxo-1,3-diazinan-1-yl)butanamide::LPV::Aluviran::CHEMBL729::ABT-378::Lopinavir	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 35					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=578	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=578&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			92727	11108093		CHEMBL729					1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22132	CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)O[C@H]1CCOC1)S(=O)(=O)c1ccc(N)cc1 |r|	InChI=1S/C25H35N3O6S/c1-18(2)15-28(35(31,32)22-10-8-20(26)9-11-22)16-24(29)23(14-19-6-4-3-5-7-19)27-25(30)34-21-12-13-33-17-21/h3-11,18,21,23-24,29H,12-17,26H2,1-2H3,(H,27,30)	YMARZQAQMVYCKC-UHFFFAOYSA-N	577	VX-478::141W94::APV::BDBM50215393::CHEMBL116::(3S)-oxolan-3-yl N-[(2S,3R)-4-[(4-aminobenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]carbamate::Amprenavir::Agenerase	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 109					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=577	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=577&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			65016	8030478		CHEMBL116					1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
22133	CC(C)[C@H](NC(=O)N(C)Cc1csc(n1)C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](Cc1ccccc1)NC(=O)OCc1cncs1)Cc1ccccc1	InChI=1S/C37H48N6O5S2/c1-24(2)33(42-36(46)43(5)20-29-22-49-35(40-29)25(3)4)34(45)39-28(16-26-12-8-6-9-13-26)18-32(44)31(17-27-14-10-7-11-15-27)41-37(47)48-21-30-19-38-23-50-30/h6-15,19,22-25,28,31-33,44H,16-18,20-21H2,1-5H3,(H,39,45)(H,41,47)(H,42,46)	NCDNCNXCDXHOMX-UHFFFAOYSA-N	520	ABT-538::Norvir::CHEMBL163::1,3-thiazol-5-ylmethyl N-[(2S,3S,5S)-3-hydroxy-5-[(2S)-3-methyl-2-{[methyl({[2-(propan-2-yl)-1,3-thiazol-4-yl]methyl})carbamoyl]amino}butanamido]-1,6-diphenylhexan-2-yl]carbamate::RTV::Ritonavir	Dimer of Gag-Pol polyprotein [489-587]	Human immunodeficiency virus 1		 67					4.5000	30.00 C	Curated from the literature by BindingDB	10.1016/j.bmcl.2005.03.008	10.7270/Q2SQ8XNQ	15837308	aid1796876		Yeung, CM; Klein, LL; Flentge, CA; Randolph, JT; Zhao, C; Sun, M; Dekhtyar, T; Stoll, VS; Kempf, DJ	5/2/2005	12/3/2006	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=520	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=520&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search			392622	8030461		CHEMBL163					1	PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF	9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G	Gag-Pol polyprotein	POL_HV1N5	P12497																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
