BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
30243	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	Xarelto::BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib	RAF proto-oncogene serine/threonine-protein kinase [305-648]	Homo sapiens		 6					8.2000	32.00 C	Curated from the literature by BindingDB	10.1158/0008-5472.CAN-04-1443	10.7270/Q2H70D2J	15466206	aid1797545		Wilhelm, SM; Carter, C; Tang, L; Wilkie, D; McNabola, A; Rong, H; Chen, C; Zhang, X; Vincent, P; McHugh, M; Cao, Y; Shujath, J; Gawlak, S; Eveleigh, D; Rowley, B; Liu, L; Adnane, L; Lynch, M; Auclair, D; Taylor, I; Gedrich, R; Voznesensky, A; Riedl, B; Post, LE; Bollag, G; Trail, PA	10/1/2004	7/18/2007	Bayer Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1748&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B305-648%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B305-648%5D&column=ki&startPg=0&Increment=50&submit=Search	BAX	3GCS,4ASD,3WZE,5HI2,3HEG,1UWH,1UWJ,3RGF	216239	46516901		CHEMBL1336	DB00398				1	WSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF	8U1L,8CPD,8CHF,3OMV,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
30244	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	Xarelto::BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib	Serine/threonine-protein kinase B-raf [409-765]	Homo sapiens		 22					8.2000	32.00 C	Curated from the literature by BindingDB	10.1158/0008-5472.CAN-04-1443	10.7270/Q2H70D2J	15466206	aid1797545		Wilhelm, SM; Carter, C; Tang, L; Wilkie, D; McNabola, A; Rong, H; Chen, C; Zhang, X; Vincent, P; McHugh, M; Cao, Y; Shujath, J; Gawlak, S; Eveleigh, D; Rowley, B; Liu, L; Adnane, L; Lynch, M; Auclair, D; Taylor, I; Gedrich, R; Voznesensky, A; Riedl, B; Post, LE; Bollag, G; Trail, PA	10/1/2004	7/18/2007	Bayer Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1749&target=Serine%2Fthreonine-protein+kinase+B-raf+%5B409-765%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Serine%2Fthreonine-protein+kinase+B-raf+%5B409-765%5D&column=ki&startPg=0&Increment=50&submit=Search	BAX	3GCS,4ASD,3WZE,5HI2,3HEG,1UWH,1UWJ,3RGF	216239	46516901		CHEMBL1336	DB00398				1	SLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPV	8VYO,7MFF,7MFE,7MFD,6UAN,8DGT,8DGS,6Q0T,6Q0K,6Q0J,6NYB,3II5,7SHV,6U2G,4PP7,4G9C,4EHE,4E4X,4E26,3TV6,3TV4,3SKC,3Q4C,3PSD,3PSB,3PRI,3PRF,3PPK,3PPJ,3D4Q,4MNE,5FD2,4MBJ,5HIE,4KSQ,4KSP,4FC0,4DBN,3Q96,6N0Q,6B8U,5VAM,5VAL,5CT7,2FB8,9AXY,9AXX,8QQG,4H58,6N0P,4XV3,4XV2,4XV1,6V34	Serine/threonine-protein kinase B-raf	BRAF_HUMAN	P15056	A4D1T4 B6HY61 B6HY62 B6HY63 B6HY64 B6HY65 B6HY66 Q13878 Q3MIN6 Q9UDP8 Q9Y6T3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
30245	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	Xarelto::BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib	Serine/threonine-protein kinase B-raf [410-766,V600E]	Homo sapiens		 38					8.2000	32.00 C	Curated from the literature by BindingDB	10.1158/0008-5472.CAN-04-1443	10.7270/Q2H70D2J	15466206	aid1797545		Wilhelm, SM; Carter, C; Tang, L; Wilkie, D; McNabola, A; Rong, H; Chen, C; Zhang, X; Vincent, P; McHugh, M; Cao, Y; Shujath, J; Gawlak, S; Eveleigh, D; Rowley, B; Liu, L; Adnane, L; Lynch, M; Auclair, D; Taylor, I; Gedrich, R; Voznesensky, A; Riedl, B; Post, LE; Bollag, G; Trail, PA	10/1/2004	7/18/2007	Bayer Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1750&target=Serine%2Fthreonine-protein+kinase+B-raf+%5B410-766%2CV600E%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Serine%2Fthreonine-protein+kinase+B-raf+%5B410-766%2CV600E%5D&column=ki&startPg=0&Increment=50&submit=Search	BAX	3GCS,4ASD,3WZE,5HI2,3HEG,1UWH,1UWJ,3RGF	216239	46516901		CHEMBL1336	DB00398				1	LTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH	8VYR,8VYP,7ZR6,7ZR5,7ZR0,8VYW,4MNF,5C9C,4G9R,4EHG,1UWJ,6N0P,8F7P,8F7O	Serine/threonine-protein kinase B-raf	BRAF_HUMAN	P15056	A4D1T4 B6HY61 B6HY62 B6HY63 B6HY64 B6HY65 B6HY66 Q13878 Q3MIN6 Q9UDP8 Q9Y6T3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
30246	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	Xarelto::BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib	Vascular endothelial growth factor receptor 2	Homo sapiens		 90					7.5000	22.00 C	Curated from the literature by BindingDB	10.1158/0008-5472.CAN-04-1443	10.7270/Q2H70D2J	15466206	aid1797546		Wilhelm, SM; Carter, C; Tang, L; Wilkie, D; McNabola, A; Rong, H; Chen, C; Zhang, X; Vincent, P; McHugh, M; Cao, Y; Shujath, J; Gawlak, S; Eveleigh, D; Rowley, B; Liu, L; Adnane, L; Lynch, M; Auclair, D; Taylor, I; Gedrich, R; Voznesensky, A; Riedl, B; Post, LE; Bollag, G; Trail, PA	10/1/2004	7/18/2007	Bayer Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=692&target=Vascular+endothelial+growth+factor+receptor+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Vascular+endothelial+growth+factor+receptor+2&column=ki&startPg=0&Increment=50&submit=Search	BAX	3GCS,4ASD,3WZE,5HI2,3HEG,1UWH,1UWJ,3RGF	216239	46516901		CHEMBL1336	DB00398				1	MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV	3V2A,1Y6B,1Y6A,3VHE,3VID,3C7Q,5OYJ,3S37,3S36,3S35,3KVQ	Vascular endothelial growth factor receptor 2	VGFR2_HUMAN	P35968	A2RRS0 B5A925 C5IFA0 O60723 Q14178																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
30247	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	Xarelto::BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib	Vascular endothelial growth factor receptor 2	Mus musculus		 15					7.5000	22.00 C	Curated from the literature by BindingDB	10.1158/0008-5472.CAN-04-1443	10.7270/Q2H70D2J	15466206	aid1797546		Wilhelm, SM; Carter, C; Tang, L; Wilkie, D; McNabola, A; Rong, H; Chen, C; Zhang, X; Vincent, P; McHugh, M; Cao, Y; Shujath, J; Gawlak, S; Eveleigh, D; Rowley, B; Liu, L; Adnane, L; Lynch, M; Auclair, D; Taylor, I; Gedrich, R; Voznesensky, A; Riedl, B; Post, LE; Bollag, G; Trail, PA	10/1/2004	7/18/2007	Bayer Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002148&target=Vascular+endothelial+growth+factor+receptor+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Vascular+endothelial+growth+factor+receptor+2&column=ki&startPg=0&Increment=50&submit=Search	BAX	3GCS,4ASD,3WZE,5HI2,3HEG,1UWH,1UWJ,3RGF	216239	46516901		CHEMBL1336	DB00398				1	MESKALLAVALWFCVETRAASVGLPGDFLHPPKLSTQKDILTILANTTLQITCRGQRDLDWLWPNAQRDSEERVLVTECGGGDSIFCKTLTIPRVVGNDTGAYKCSYRDVDIASTVYVYVRDYRSPFIASVSDQHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPEKRFVPDGNRISWDSEIGFTLPSYMISYAGMVFCEAKINDETYQSIMYIVVVVGYRIYDVILSPPHEIELSAGEKLVLNCTARTELNVGLDFTWHSPPSKSHHKKIVNRDVKPFPGTVAKMFLSTLTIESVTKSDQGEYTCVASSGRMIKRNRTFVRVHTKPFIAFGSGMKSLVEATVGSQVRIPVKYLSYPAPDIKWYRNGRPIESNYTMIVGDELTIMEVTERDAGNYTVILTNPISMEKQSHMVSLVVNVPPQIGEKALISPMDSYQYGTMQTLTCTVYANPPLHHIQWYWQLEEACSYRPGQTSPYACKEWRHVEDFQGGNKIEVTKNQYALIEGKNKTVSTLVIQAANVSALYKCEAINKAGRGERVISFHVIRGPEITVQPAAQPTEQESVSLLCTADRNTFENLTWYKLGSQATSVHMGESLTPVCKNLDALWKLNGTMFSNSTNDILIVAFQNASLQDQGDYVCSAQDKKTKKRHCLVKQLIILERMAPMITGNLENQTTTIGETIEVTCPASGNPTPHITWFKDNETLVEDSGIVLRDGNRNLTIRRVRKEDGGLYTCQACNVLGCARAETLFIIEGAQEKTNLEVIILVGTAVIAMFFWLLLVILVRTVKRANEGELKTGYLSIVMDPDELPLDERCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCKTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFSKFGNLSTYLRGKRNEFVPYKSKGARFRQGKDYVGELSVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEASEELYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHEDPNQRPSFSELVEHLGNLLQANAQQDGKDYIVLPMSETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISHYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDSQTDSGMVLASEELKTLEDRNKLSPSFGGMMPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSDEAGLLKMVDAAVHADSGTTLQLTSCLNGSGPVPAPPPTPGNHERGAA		Vascular endothelial growth factor receptor 2	VGFR2_MOUSE	P35918	C5H7S5 Q8VCD0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
30248	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	Xarelto::BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib	Vascular endothelial growth factor receptor 3	Mus musculus		 20					7.5000	22.00 C	Curated from the literature by BindingDB	10.1158/0008-5472.CAN-04-1443	10.7270/Q2H70D2J	15466206	aid1797546		Wilhelm, SM; Carter, C; Tang, L; Wilkie, D; McNabola, A; Rong, H; Chen, C; Zhang, X; Vincent, P; McHugh, M; Cao, Y; Shujath, J; Gawlak, S; Eveleigh, D; Rowley, B; Liu, L; Adnane, L; Lynch, M; Auclair, D; Taylor, I; Gedrich, R; Voznesensky, A; Riedl, B; Post, LE; Bollag, G; Trail, PA	10/1/2004	7/18/2007	Bayer Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1756&target=Vascular+endothelial+growth+factor+receptor+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Vascular+endothelial+growth+factor+receptor+3&column=ki&startPg=0&Increment=50&submit=Search	BAX	3GCS,4ASD,3WZE,5HI2,3HEG,1UWH,1UWJ,3RGF	216239	46516901		CHEMBL1336	DB00398				1	MQPGAALNLRLWLCLGLLQGLANGYSMTPPTLNITEDSYVIDTGDSLSISCRGQHPLEWTWPGAQEVLTTGGKDSEDTRVVHDCEGTEARPYCKVLLLAQTHANNTGSYHCYYKYIKARIEGTTAASTYVFVRDFKHPFINKPDTLLVNRKDSMWVPCLVSIPGLNITLRSQSSALHPDGQEVLWDDRRGMRVPTQLLRDALYLQCETTWGDQNFLSNLFVVHITGNELYDIQLYPKKSMELLVGEKLVLNCTVWAEFDSGVTFDWDYPGKQAERAKWVPERRSQQTHTELSSILTIHNVSQNDLGPYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLAAYPPPEFQWYKDRKAVTGRHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELVVNVPPHIHEKEASSPSIYSRHSRQTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSLRRRQQRDGMPQCRDWKEVTTQDAVNPIESLDSWTEFVEGKNKTVSKLVIQDANVSAMYKCVVVNKVGQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHDAQGNPLLLDCKNVHLFATPLEANLEEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRSQDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEKESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILIGTGVIAVFFWVLLLLIFCNMKRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEFPRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKILIHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRVKRDTFNPYAEKSPEQRRRFRAMVEGAKADRRRPGSSDRALFTRFLMGKGSARRAPLVQEAEDLWLSPLTMEDLVCYSFQVARGMEFLASRKCIHRDLAARNILLSESDIVKICDFGLARDIYKDPDYVRKGSARLPLKWMAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKDGTRMRAPELATPAIRHIMQSCWSGDPKARPAFSDLVEILGDLLQGGGWQEEEEERMALHSSQSSEEDGFMQASTTALHITEADADDSPPSMHCHSLAARYYNCVSFPGRLARGTKTPGSSRMKTFEELPMTPTTYKASMDNQTDSGMVLASEEFEELESRHRPEGSFSCKGPGQHMDIPRGHPDPQGRRRRPTQGAQGGKVFYNNEYGEVSQPCTEGDCCPSAGSTFFADSSY		Vascular endothelial growth factor receptor 3	VGFR3_MOUSE	P35917																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
30249	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	Xarelto::BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib	Platelet-derived growth factor receptor beta	Mus musculus		 57					7.5000	22.00 C	Curated from the literature by BindingDB	10.1158/0008-5472.CAN-04-1443	10.7270/Q2H70D2J	15466206	aid1797546		Wilhelm, SM; Carter, C; Tang, L; Wilkie, D; McNabola, A; Rong, H; Chen, C; Zhang, X; Vincent, P; McHugh, M; Cao, Y; Shujath, J; Gawlak, S; Eveleigh, D; Rowley, B; Liu, L; Adnane, L; Lynch, M; Auclair, D; Taylor, I; Gedrich, R; Voznesensky, A; Riedl, B; Post, LE; Bollag, G; Trail, PA	10/1/2004	7/18/2007	Bayer Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=633&target=Platelet-derived+growth+factor+receptor+beta&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Platelet-derived+growth+factor+receptor+beta&column=ki&startPg=0&Increment=50&submit=Search	BAX		216239	46516901		CHEMBL1336	DB00398				1	MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALPVGFSLPSHLNLTGESDGGYMDMSKDESIDYVPMLDMKGDIKYADIESPSYMAPYDNYVPSAPERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDYIIPLPDPKPDVADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLEQPQDSGCPGPLAEAEDSFL		Platelet-derived growth factor receptor beta	PGFRB_MOUSE	P05622	E9QPE2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
30250	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	Xarelto::BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib	Aromatase	Homo sapiens		 58					7.5000	22.00 C	Curated from the literature by BindingDB	10.1158/0008-5472.CAN-04-1443	10.7270/Q2H70D2J	15466206	aid1797546		Wilhelm, SM; Carter, C; Tang, L; Wilkie, D; McNabola, A; Rong, H; Chen, C; Zhang, X; Vincent, P; McHugh, M; Cao, Y; Shujath, J; Gawlak, S; Eveleigh, D; Rowley, B; Liu, L; Adnane, L; Lynch, M; Auclair, D; Taylor, I; Gedrich, R; Voznesensky, A; Riedl, B; Post, LE; Bollag, G; Trail, PA	10/1/2004	7/18/2007	Bayer Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1024&target=Aromatase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Aromatase&column=ki&startPg=0&Increment=50&submit=Search	BAX	3GCS,4ASD,3WZE,5HI2,3HEG,1UWH,1UWJ,3RGF	216239	46516901		CHEMBL1336	DB00398				1	MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLHPDETKNMLEMIFTPRNSDRCLEH	5JL9,5JL7,5JL6,5JKW,5JKV,4GL7,4GL5,3S7S,3S79,3EQM	Aromatase	CP19A_HUMAN	P11511	Q16731 Q3B764 Q58FA0 Q8IYJ7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
30251	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	Xarelto::BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib	Mast/stem cell growth factor receptor Kit	Homo sapiens		 68					7.5000	22.00 C	Curated from the literature by BindingDB	10.1158/0008-5472.CAN-04-1443	10.7270/Q2H70D2J	15466206	aid1797546		Wilhelm, SM; Carter, C; Tang, L; Wilkie, D; McNabola, A; Rong, H; Chen, C; Zhang, X; Vincent, P; McHugh, M; Cao, Y; Shujath, J; Gawlak, S; Eveleigh, D; Rowley, B; Liu, L; Adnane, L; Lynch, M; Auclair, D; Taylor, I; Gedrich, R; Voznesensky, A; Riedl, B; Post, LE; Bollag, G; Trail, PA	10/1/2004	7/18/2007	Bayer Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=359&target=Mast%2Fstem+cell+growth+factor+receptor+Kit&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Mast%2Fstem+cell+growth+factor+receptor+Kit&column=ki&startPg=0&Increment=50&submit=Search	BAX	3GCS,4ASD,3WZE,5HI2,3HEG,1UWH,1UWJ,3RGF	216239	46516901		CHEMBL1336	DB00398				1	MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV	2EC8,4U0I,6MOB,1T46,1PKG,6KLA,6ITV,6ITT,1T45,3G0E,3G0F,8PQF,8PQE,8PQD,8PQC,8PQB,8PQA,8PQ9,6XVB,6XVA,6XV9,6GQM,6GQL,6GQK,6GQJ	Mast/stem cell growth factor receptor Kit	KIT_HUMAN	P10721	B5A956 D5LXN2 D5M931 F5H8F8 Q6IQ28 Q99662 Q9UM99																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
30252	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	Xarelto::BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib	Fibroblast growth factor receptor 1	Homo sapiens		 580					7.5000	22.00 C	Curated from the literature by BindingDB	10.1158/0008-5472.CAN-04-1443	10.7270/Q2H70D2J	15466206	aid1797546		Wilhelm, SM; Carter, C; Tang, L; Wilkie, D; McNabola, A; Rong, H; Chen, C; Zhang, X; Vincent, P; McHugh, M; Cao, Y; Shujath, J; Gawlak, S; Eveleigh, D; Rowley, B; Liu, L; Adnane, L; Lynch, M; Auclair, D; Taylor, I; Gedrich, R; Voznesensky, A; Riedl, B; Post, LE; Bollag, G; Trail, PA	10/1/2004	7/18/2007	Bayer Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=694&target=Fibroblast+growth+factor+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Fibroblast+growth+factor+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	BAX	3GCS,4ASD,3WZE,5HI2,3HEG,1UWH,1UWJ,3RGF	216239	46516901		CHEMBL1336	DB00398				1	MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR	8JQI,5A46,3GQI,5ZV2,3RHX,3RI1,1OEC,1GJO,7OZY,1EVT,5W59	Fibroblast growth factor receptor 1	FGFR1_HUMAN	P11362	A8K6T9 A8K8V5 C1KBH8 P17049 Q02063 Q02065 Q14306 Q14307 Q53H63 Q59H40 Q5BJG2 Q8N685 Q9UD50 Q9UDF0 Q9UDF1 Q9UDF2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
