BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50820720	CCCCCCN(CCCCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C28H36N2O2/c1-3-5-7-14-20-30(21-15-8-6-4-2)28(32)27(31)25-23-18-12-13-19-24(23)29-26(25)22-16-10-9-11-17-22/h9-13,16-19,29H,3-8,14-15,20-21H2,1-2H3	IMYAAECOCXULOC-UHFFFAOYSA-N	50143220	N,N-dihexyl-2-oxo-2-(2-phenyl-1H-indol-3-yl)acetamide::N,N-Dihexyl-2-oxo-2-(2-phenyl-1H-indol-3-yl)-acetamide::CHEMBL294625	Translocator protein	Rattus norvegicus	 1.4								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143220	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143220&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11384950	104032436		CHEMBL294625					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820721	CCCCCCN(CCCCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(F)cc1	InChI=1S/C28H35FN2O2/c1-3-5-7-11-19-31(20-12-8-6-4-2)28(33)27(32)25-23-13-9-10-14-24(23)30-26(25)21-15-17-22(29)18-16-21/h9-10,13-18,30H,3-8,11-12,19-20H2,1-2H3	IYLUJXJVFRCGSA-UHFFFAOYSA-N	22038	2-[2-(4-fluorophenyl)-1H-indol-3-yl]-N,N-dihexyl-2-oxoacetamide::CHEMBL53430	Translocator protein	Rattus norvegicus	 0.37								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=22038	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=22038&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11744496	49845855		CHEMBL53430					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820722	CC(C)N(C(C)C)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C22H24N2O2/c1-14(2)24(15(3)4)22(26)21(25)19-17-12-8-9-13-18(17)23-20(19)16-10-6-5-7-11-16/h5-15,23H,1-4H3	XXJCDCRWHKTQGO-UHFFFAOYSA-N	50143221	N,N-Diisopropyl-2-oxo-2-(2-phenyl-1H-indol-3-yl)-acetamide::CHEMBL301836	Translocator protein	Rattus norvegicus	 103								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143221	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143221&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11405325	104032437		CHEMBL301836					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820723	O=C(N1CCCCCC1)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C22H22N2O2/c25-21(22(26)24-14-8-1-2-9-15-24)19-17-12-6-7-13-18(17)23-20(19)16-10-4-3-5-11-16/h3-7,10-13,23H,1-2,8-9,14-15H2	JZYDLFIKBFDTJA-UHFFFAOYSA-N	50143222	1-Azepan-1-yl-2-(2-phenyl-1H-indol-3-yl)-ethane-1,2-dione::CHEMBL54740	Translocator protein	Rattus norvegicus	 33								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143222	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143222&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11416714	104032438		CHEMBL54740					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820724	CCCN(CCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C22H24N2O2/c1-3-14-24(15-4-2)22(26)21(25)19-17-12-8-9-13-18(17)23-20(19)16-10-6-5-7-11-16/h5-13,23H,3-4,14-15H2,1-2H3	RQQYRSNTFLXYMH-UHFFFAOYSA-N	50143223	2-oxo-2-(2-phenyl-1H-indol-3-yl)-N,N-dipropylacetamide::2-Oxo-2-(2-phenyl-1H-indol-3-yl)-N,N-dipropyl-acetamide::CHEMBL56058	Translocator protein	Rattus norvegicus	 12.2								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143223	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143223&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11314054	104032439		CHEMBL56058					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820725	CCCN(CCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(C)cc1	InChI=1S/C23H26N2O2/c1-4-14-25(15-5-2)23(27)22(26)20-18-8-6-7-9-19(18)24-21(20)17-12-10-16(3)11-13-17/h6-13,24H,4-5,14-15H2,1-3H3	WCIYVVCNCVAWIC-UHFFFAOYSA-N	50143224	2-Oxo-N,N-dipropyl-2-(2-p-tolyl-1H-indol-3-yl)-acetamide::CHEMBL53255	Translocator protein	Rattus norvegicus	 5.5								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143224	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143224&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11394368	104032440		CHEMBL53255					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820726	CCCCN(CCCC)C(=O)C(=O)c1c([nH]c2ccc(Cl)cc12)-c1ccc(Cl)cc1	InChI=1S/C24H26Cl2N2O2/c1-3-5-13-28(14-6-4-2)24(30)23(29)21-19-15-18(26)11-12-20(19)27-22(21)16-7-9-17(25)10-8-16/h7-12,15,27H,3-6,13-14H2,1-2H3	WXPMBHGLFPGGNH-UHFFFAOYSA-N	50143225	N,N-Dibutyl-2-[5-chloro-2-(4-chloro-phenyl)-1H-indol-3-yl]-2-oxo-acetamide::CHEMBL300762	Translocator protein	Rattus norvegicus	 1.9								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143225	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143225&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11201644	104032441		CHEMBL300762					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820727	CCCCCN(CCCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C26H32N2O2/c1-3-5-12-18-28(19-13-6-4-2)26(30)25(29)23-21-16-10-11-17-22(21)27-24(23)20-14-8-7-9-15-20/h7-11,14-17,27H,3-6,12-13,18-19H2,1-2H3	FHQLVDDFLBGDOO-UHFFFAOYSA-N	50143226	2-Oxo-N,N-dipentyl-2-(2-phenyl-1H-indol-3-yl)-acetamide::CHEMBL291774	Translocator protein	Rattus norvegicus	 16								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143226	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143226&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11350240	104032442		CHEMBL291774					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820728	CCCCN(CCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(F)cc1	InChI=1S/C24H27FN2O2/c1-3-5-15-27(16-6-4-2)24(29)23(28)21-19-9-7-8-10-20(19)26-22(21)17-11-13-18(25)14-12-17/h7-14,26H,3-6,15-16H2,1-2H3	WFWFXLUCSLGFIB-UHFFFAOYSA-N	50143227	N,N-Dibutyl-2-[2-(4-fluoro-phenyl)-1H-indol-3-yl]-2-oxo-acetamide::CHEMBL54403	Translocator protein	Rattus norvegicus	 2.4								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143227	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143227&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11749759	104032443		CHEMBL54403					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820729	CCCCN(CCCC)C(=O)C(=O)c1c([nH]c2ccc(Cl)cc12)-c1ccccc1	InChI=1S/C24H27ClN2O2/c1-3-5-14-27(15-6-4-2)24(29)23(28)21-19-16-18(25)12-13-20(19)26-22(21)17-10-8-7-9-11-17/h7-13,16,26H,3-6,14-15H2,1-2H3	XOXZWOHFITYZGG-UHFFFAOYSA-N	50143228	N,N-Dibutyl-2-(5-chloro-2-phenyl-1H-indol-3-yl)-2-oxo-acetamide::CHEMBL54066	Translocator protein	Rattus norvegicus	 4.91								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143228	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143228&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11235265	104032444		CHEMBL54066					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820730	CCCCCCN(CCCCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(Cl)cc1	InChI=1S/C28H35ClN2O2/c1-3-5-7-11-19-31(20-12-8-6-4-2)28(33)27(32)25-23-13-9-10-14-24(23)30-26(25)21-15-17-22(29)18-16-21/h9-10,13-18,30H,3-8,11-12,19-20H2,1-2H3	RGUOOELDJCFEAS-UHFFFAOYSA-N	50143231	2-[2-(4-Chloro-phenyl)-1H-indol-3-yl]-N,N-dihexyl-2-oxo-acetamide::CHEMBL55162	Translocator protein	Rattus norvegicus	 0.55								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143231	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143231&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11167242	104032447		CHEMBL55162					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820731	CCCCCCN(CCCCCC)C(=O)C(=O)c1c([nH]c2ccc(Cl)cc12)-c1ccccc1	InChI=1S/C28H35ClN2O2/c1-3-5-7-12-18-31(19-13-8-6-4-2)28(33)27(32)25-23-20-22(29)16-17-24(23)30-26(25)21-14-10-9-11-15-21/h9-11,14-17,20,30H,3-8,12-13,18-19H2,1-2H3	ADCRXAHEWLERII-UHFFFAOYSA-N	50143229	2-(5-Chloro-2-phenyl-1H-indol-3-yl)-N,N-dihexyl-2-oxo-acetamide::CHEMBL300128	Translocator protein	Rattus norvegicus	 58.4								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143229	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143229&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11340296	104032445		CHEMBL300128					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820732	CCCN(CCC)C(=O)C(=O)c1c([nH]c2ccc(Cl)cc12)-c1ccc(Cl)cc1	InChI=1S/C22H22Cl2N2O2/c1-3-11-26(12-4-2)22(28)21(27)19-17-13-16(24)9-10-18(17)25-20(19)14-5-7-15(23)8-6-14/h5-10,13,25H,3-4,11-12H2,1-2H3	CZZNAZRFMIBLFO-UHFFFAOYSA-N	50143232	2-(5-chloro-2-(4-chlorophenyl)-1H-indol-3-yl)-2-oxo-N,N-dipropylacetamide::2-[5-Chloro-2-(4-chloro-phenyl)-1H-indol-3-yl]-2-oxo-N,N-dipropyl-acetamide::CHEMBL55781	Translocator protein	Rattus norvegicus	 0.62								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143232	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143232&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11373424	104032448		CHEMBL55781					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820733	CN1c2ccc(Cl)cc2C(=NCC1=O)c1ccc(Cl)cc1 |c:10|	InChI=1S/C16H12Cl2N2O/c1-20-14-7-6-12(18)8-13(14)16(19-9-15(20)21)10-2-4-11(17)5-3-10/h2-8H,9H2,1H3	PUMYFTJOWAJIKF-UHFFFAOYSA-N	22040	Ro5-4864::4&#39; Cl-diazepam::4 -chlorodiazepam::7-chloro-5-(4-chlorophenyl)-1-methyl-2,3-dihydro-1H-1,4-benzodiazepin-2-one::Ro-4864::CHEMBL286346::7-chloro-5-(4-chlorophenyl)-1-methyl-1,3-dihydro-2H-1,4-benzodiazepin-2-one::Ro-05-4864::Ro 5-4864	Translocator protein	Rattus norvegicus	 23								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=22040	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=22040&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			1688	49845857		CHEMBL286346					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820734	O=C(N1CCCC1)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C20H18N2O2/c23-19(20(24)22-12-6-7-13-22)17-15-10-4-5-11-16(15)21-18(17)14-8-2-1-3-9-14/h1-5,8-11,21H,6-7,12-13H2	LSZIUVJVJYFTLB-UHFFFAOYSA-N	50143230	1-(2-Phenyl-1H-indol-3-yl)-2-pyrrolidin-1-yl-ethane-1,2-dione::CHEMBL55648	Translocator protein	Rattus norvegicus	 2400								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143230	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143230&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			2225805	104032446		CHEMBL55648					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820735	CCCN(CCC)C(=O)Cc1c(nc2ccc(Cl)cn12)-c1ccc(Cl)cc1	InChI=1S/C21H23Cl2N3O/c1-3-11-25(12-4-2)20(27)13-18-21(15-5-7-16(22)8-6-15)24-19-10-9-17(23)14-26(18)19/h5-10,14H,3-4,11-13H2,1-2H3	JRTIDHTUMYMPRU-UHFFFAOYSA-N	22041	2-[6-chloro-2-(4-chlorophenyl)imidazo[1,2-a]pyridin-3-yl]-N,N-dipropylacetamide::S-800342::Ananxyl::CHEMBL54349::Alpidem	Translocator protein	Rattus norvegicus	 7								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=22041	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=22041&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			54897	49845858		CHEMBL54349					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820736	CCCCN(CCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(Cl)cc1	InChI=1S/C24H27ClN2O2/c1-3-5-15-27(16-6-4-2)24(29)23(28)21-19-9-7-8-10-20(19)26-22(21)17-11-13-18(25)14-12-17/h7-14,26H,3-6,15-16H2,1-2H3	XWAKPXGLAPHIDZ-UHFFFAOYSA-N	50143233	N,N-Dibutyl-2-[2-(4-chloro-phenyl)-1H-indol-3-yl]-2-oxo-acetamide::CHEMBL292847	Translocator protein	Rattus norvegicus	 1								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143233	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143233&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11223628	104032449		CHEMBL292847					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820737	CCCN(CCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(Cl)cc1	InChI=1S/C22H23ClN2O2/c1-3-13-25(14-4-2)22(27)21(26)19-17-7-5-6-8-18(17)24-20(19)15-9-11-16(23)12-10-15/h5-12,24H,3-4,13-14H2,1-2H3	OHAFUSRKTGKMIV-UHFFFAOYSA-N	50143234	2-[2-(4-Chloro-phenyl)-1H-indol-3-yl]-2-oxo-N,N-dipropyl-acetamide::2-(2-(4-chlorophenyl)-1H-indol-3-yl)-2-oxo-N,N-dipropylacetamide::CHEMBL294423	Translocator protein	Rattus norvegicus	 4.65								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143234	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143234&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11749395	104032450		CHEMBL294423					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820738	CCC(C)N(C(C)CC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C24H28N2O2/c1-5-16(3)26(17(4)6-2)24(28)23(27)21-19-14-10-11-15-20(19)25-22(21)18-12-8-7-9-13-18/h7-17,25H,5-6H2,1-4H3	NZAVIDOPKXJHJC-UHFFFAOYSA-N	50143237	N,N-Di-sec-butyl-2-oxo-2-(2-phenyl-1H-indol-3-yl)-acetamide::CHEMBL55190	Translocator protein	Rattus norvegicus	 17								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143237	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143237&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11314888	104032453		CHEMBL55190					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820739	CCCCCCN(CCCCCC)C(=O)C(=O)c1c([nH]c2ccc(Cl)cc12)-c1ccc(Cl)cc1	InChI=1S/C28H34Cl2N2O2/c1-3-5-7-9-17-32(18-10-8-6-4-2)28(34)27(33)25-23-19-22(30)15-16-24(23)31-26(25)20-11-13-21(29)14-12-20/h11-16,19,31H,3-10,17-18H2,1-2H3	KOYCOJWAFKTRII-UHFFFAOYSA-N	50143238	2-[5-Chloro-2-(4-chloro-phenyl)-1H-indol-3-yl]-N,N-dihexyl-2-oxo-acetamide::CHEMBL53259	Translocator protein	Rattus norvegicus	 5.8								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143238	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143238&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11191271	104032454		CHEMBL53259					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820740	O=C(N1CCCCC1)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C21H20N2O2/c24-20(21(25)23-13-7-2-8-14-23)18-16-11-5-6-12-17(16)22-19(18)15-9-3-1-4-10-15/h1,3-6,9-12,22H,2,7-8,13-14H2	VGZLFDCJSLGJOG-UHFFFAOYSA-N	50143235	1-(2-Phenyl-1H-indol-3-yl)-2-piperidin-1-yl-ethane-1,2-dione::CHEMBL299975	Translocator protein	Rattus norvegicus	 665								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143235	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143235&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			3707234	104032451		CHEMBL299975					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820741	CCCCN(CCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C24H28N2O2/c1-3-5-16-26(17-6-4-2)24(28)23(27)21-19-14-10-11-15-20(19)25-22(21)18-12-8-7-9-13-18/h7-15,25H,3-6,16-17H2,1-2H3	GSVWDNMXKQSVQJ-UHFFFAOYSA-N	50143236	N,N-Dibutyl-2-oxo-2-(2-phenyl-1H-indol-3-yl)-acetamide::N,N-dibutyl-2-oxo-2-(2-phenyl-1H-indol-3-yl)acetamide::CHEMBL431938	Translocator protein	Rattus norvegicus	 7.5								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143236	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143236&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11222629	104032452		CHEMBL431938					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820742	CCN(CC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C20H20N2O2/c1-3-22(4-2)20(24)19(23)17-15-12-8-9-13-16(15)21-18(17)14-10-6-5-7-11-14/h5-13,21H,3-4H2,1-2H3	PAKUQEWBWBPVQY-UHFFFAOYSA-N	50143239	CHEMBL55126::cid_2231591::N,N-Diethyl-2-oxo-2-(2-phenyl-1H-indol-3-yl)-acetamide	Translocator protein	Rattus norvegicus	 43								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143239	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143239&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			2231591	104032455		CHEMBL55126					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820743	CCCCN(CCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(C)cc1	InChI=1S/C25H30N2O2/c1-4-6-16-27(17-7-5-2)25(29)24(28)22-20-10-8-9-11-21(20)26-23(22)19-14-12-18(3)13-15-19/h8-15,26H,4-7,16-17H2,1-3H3	BSDGXGWUUSDLDS-UHFFFAOYSA-N	50143240	N,N-Dibutyl-2-oxo-2-(2-p-tolyl-1H-indol-3-yl)-acetamide::CHEMBL431747	Translocator protein	Rattus norvegicus	 3.8								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143240	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143240&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11361307	104032456		CHEMBL431747					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820744	CCCNC(=O)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C19H18N2O2/c1-2-12-20-19(23)18(22)16-14-10-6-7-11-15(14)21-17(16)13-8-4-3-5-9-13/h3-11,21H,2,12H2,1H3,(H,20,23)	OICSQNDQHJZXDZ-UHFFFAOYSA-N	50143243	2-Oxo-2-(2-phenyl-1H-indol-3-yl)-N-propyl-acetamide::CHEMBL53277	Translocator protein	Rattus norvegicus	 815								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143243	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143243&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			9429785	104032459		CHEMBL53277					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820745	CCCN(CCC)C(=O)C(=O)c1c([nH]c2ccc(Cl)cc12)-c1ccccc1	InChI=1S/C22H23ClN2O2/c1-3-12-25(13-4-2)22(27)21(26)19-17-14-16(23)10-11-18(17)24-20(19)15-8-6-5-7-9-15/h5-11,14,24H,3-4,12-13H2,1-2H3	BTSIMBPOPMQFJZ-UHFFFAOYSA-N	50143242	2-(5-Chloro-2-phenyl-1H-indol-3-yl)-2-oxo-N,N-dipropyl-acetamide::2-(5-chloro-2-phenyl-1H-indol-3-yl)-2-oxo-N,N-dipropylacetamide::CHEMBL54627	Translocator protein	Rattus norvegicus	 2.8								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143242	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143242&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11326550	104032458		CHEMBL54627					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820746	CCCCNC(=O)C(=O)c1c([nH]c2ccccc12)-c1ccccc1	InChI=1S/C20H20N2O2/c1-2-3-13-21-20(24)19(23)17-15-11-7-8-12-16(15)22-18(17)14-9-5-4-6-10-14/h4-12,22H,2-3,13H2,1H3,(H,21,24)	DGZPDTKVILQCJY-UHFFFAOYSA-N	50143241	N-Butyl-2-oxo-2-(2-phenyl-1H-indol-3-yl)-acetamide::CHEMBL55316	Translocator protein	Rattus norvegicus	 1167								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143241	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143241&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11738722	104032457		CHEMBL55316					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820747	CCCCCCN(CCCCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(C)cc1	InChI=1S/C29H38N2O2/c1-4-6-8-12-20-31(21-13-9-7-5-2)29(33)28(32)26-24-14-10-11-15-25(24)30-27(26)23-18-16-22(3)17-19-23/h10-11,14-19,30H,4-9,12-13,20-21H2,1-3H3	VGFVXBYVWBOHDQ-UHFFFAOYSA-N	50143245	N,N-Dihexyl-2-oxo-2-(2-p-tolyl-1H-indol-3-yl)-acetamide::CHEMBL55135	Translocator protein	Rattus norvegicus	 1.6								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143245	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143245&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11408227	104032461		CHEMBL55135					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820748	CCCN(CCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(F)cc1	InChI=1S/C22H23FN2O2/c1-3-13-25(14-4-2)22(27)21(26)19-17-7-5-6-8-18(17)24-20(19)15-9-11-16(23)12-10-15/h5-12,24H,3-4,13-14H2,1-2H3	OIGLTKDFOFMHSD-UHFFFAOYSA-N	50143244	2-[2-(4-Fluoro-phenyl)-1H-indol-3-yl]-2-oxo-N,N-dipropyl-acetamide::CHEMBL299487	Translocator protein	Rattus norvegicus	 4.28								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50143244	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50143244&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			11485400	104032460		CHEMBL299487					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50820749	CC[C@@H](C)N(C)C(=O)c1cc2ccccc2c(n1)c3ccccc3Cl	InChI=1S/C21H21ClN2O/c1-4-14(2)24(3)21(25)19-13-15-9-5-6-10-16(15)20(23-19)17-11-7-8-12-18(17)22/h5-14H,4H2,1-3H3	RAVIZVQZGXBOQO-UHFFFAOYSA-N	22032	PK 11195::PK11195::RP 52028::N-(butan-2-yl)-1-(2-chlorophenyl)-N-methylisoquinoline-3-carboxamide::PK-11195::CHEMBL15313::1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxamide::[3H]PK 11195	Translocator protein	Rattus norvegicus	 9.30								ChEMBL	10.1021/jm030973k	10.7270/Q2WQ04K6	15027878			Primofiore, G; Da Settimo, F; Taliani, S; Simorini, F; Patrizi, MP; Novellino, E; Greco, G; Abignente, E; Costa, B; Chelli, B; Martini, C	3/18/2004	11/30/2012	University of Pisa	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=22032	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=22032&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	PKA	2MGY,2N02,4RYI	1345	49845849		CHEMBL15313					1	MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE		Translocator protein	TSPO_RAT	P16257																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
