BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50024893 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccco1)C(C)(C)C InChI=1S/C18H28N2O5/c1-5-6-8-13(11-20(24)12-21)17(23)19-16(18(2,3)4)15(22)14-9-7-10-25-14/h7,9-10,12-13,16,24H,5-6,8,11H2,1-4H3,(H,19,23) VAACCYXFCGCYPX-UHFFFAOYSA-N 50137340 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-1-(furan-2-carbonyl)-2,2-dimethyl-propyl]-amide::CHEMBL347204 Peptide deformylase Escherichia coli 5 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137340 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137340&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 21305227 104027506 CHEMBL347204 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024894 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(cc1)N1CCN(CCN2CCCC2)CC1 InChI=1S/C32H51N5O4/c1-32(2,3)30(33-31(40)27(23-37(41)24-38)22-25-8-4-5-9-25)29(39)26-10-12-28(13-11-26)36-20-18-35(19-21-36)17-16-34-14-6-7-15-34/h10-13,24-25,27,30,41H,4-9,14-23H2,1-3H3,(H,33,40) GDWMRCWXJMKQFZ-UHFFFAOYSA-N 50137323 (R)-2-Cyclopentylmethyl-N-((S)-2,2-dimethyl-1-{4-[4-(2-pyrrolidin-1-yl-ethyl)-piperazin-1-yl]-benzoyl}-propyl)-3-(formyl-hydroxy-amino)-propionamide::CHEMBL409416 Peptide deformylase Escherichia coli 3 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137323 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137323&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371376 104027489 CHEMBL409416 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024895 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(N2CCC(O)CC2)c(F)c1 InChI=1S/C27H40FN3O5/c1-27(2,3)25(29-26(35)20(16-31(36)17-32)14-18-6-4-5-7-18)24(34)19-8-9-23(22(28)15-19)30-12-10-21(33)11-13-30/h8-9,15,17-18,20-21,25,33,36H,4-7,10-14,16H2,1-3H3,(H,29,35) IBOKHVLONITYHP-UHFFFAOYSA-N 50137314 (R)-2-Cyclopentylmethyl-N-{(S)-1-[3-fluoro-4-(4-hydroxy-piperidin-1-yl)-benzoyl]-2,2-dimethyl-propyl}-3-(formyl-hydroxy-amino)-propionamide::CHEMBL160164 Peptide deformylase Escherichia coli 2 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137314 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137314&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371802 104027480 CHEMBL160164 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024896 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(N2CCN(CCO)CC2)c(F)c1 InChI=1S/C28H43FN4O5/c1-28(2,3)26(30-27(37)22(18-33(38)19-35)16-20-6-4-5-7-20)25(36)21-8-9-24(23(29)17-21)32-12-10-31(11-13-32)14-15-34/h8-9,17,19-20,22,26,34,38H,4-7,10-16,18H2,1-3H3,(H,30,37) POIOHFUNIKZZMK-UHFFFAOYSA-N 50137341 (R)-2-Cyclopentylmethyl-N-((S)-1-{3-fluoro-4-[4-(2-hydroxy-ethyl)-piperazin-1-yl]-benzoyl}-2,2-dimethyl-propyl)-3-(formyl-hydroxy-amino)-propionamide::CHEMBL156163 Peptide deformylase Escherichia coli 1 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137341 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137341&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371668 104027507 CHEMBL156163 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024897 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(C)=O)C(C)(C)C InChI=1S/C15H28N2O4/c1-6-7-8-12(9-17(21)10-18)14(20)16-13(11(2)19)15(3,4)5/h10,12-13,21H,6-9H2,1-5H3,(H,16,20) VUMMRHDUGBAWSA-UHFFFAOYSA-N 50131310 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid ((S)-1-acetyl-2,2-dimethyl-propyl)-amide::CHEMBL88780 Peptide deformylase Escherichia coli 20 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50131310 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50131310&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 10424884 104022494 CHEMBL88780 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024898 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1cc(F)c(F)cc1N1CCC(O)CC1 InChI=1S/C27H39F2N3O5/c1-27(2,3)25(30-26(36)18(15-32(37)16-33)12-17-6-4-5-7-17)24(35)20-13-21(28)22(29)14-23(20)31-10-8-19(34)9-11-31/h13-14,16-19,25,34,37H,4-12,15H2,1-3H3,(H,30,36) ACTMAVUNQPFPJO-UHFFFAOYSA-N 50137324 (R)-2-Cyclopentylmethyl-N-{(S)-1-[4,5-difluoro-2-(4-hydroxy-piperidin-1-yl)-benzoyl]-2,2-dimethyl-propyl}-3-(formyl-hydroxy-amino)-propionamide::CHEMBL158092 Peptide deformylase Escherichia coli 1 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137324 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137324&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371474 104027490 CHEMBL158092 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024899 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(N2CCC[C@H]2CO)c(F)c1 InChI=1S/C27H40FN3O5/c1-27(2,3)25(29-26(35)20(15-30(36)17-33)13-18-7-4-5-8-18)24(34)19-10-11-23(22(28)14-19)31-12-6-9-21(31)16-32/h10-11,14,17-18,20-21,25,32,36H,4-9,12-13,15-16H2,1-3H3,(H,29,35) KPIGKYVXZOAYLT-UHFFFAOYSA-N 50137333 (R)-2-Cyclopentylmethyl-N-{(S)-1-[3-fluoro-4-((S)-2-hydroxymethyl-pyrrolidin-1-yl)-benzoyl]-2,2-dimethyl-propyl}-3-(formyl-hydroxy-amino)-propionamide::CHEMBL348314 Peptide deformylase Escherichia coli 2 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137333 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137333&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371279 104027499 CHEMBL348314 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024900 COc1ccc(cc1)C(=O)[C@@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(C)(C)C InChI=1S/C23H34N2O5/c1-23(2,3)21(20(27)17-9-11-19(30-4)12-10-17)24-22(28)18(14-25(29)15-26)13-16-7-5-6-8-16/h9-12,15-16,18,21,29H,5-8,13-14H2,1-4H3,(H,24,28) WGMOBZCFZVTRJE-UHFFFAOYSA-N 50137318 (R)-2-Cyclopentylmethyl-3-(formyl-hydroxy-amino)-N-[(S)-1-(4-methoxy-benzoyl)-2,2-dimethyl-propyl]-propionamide::CHEMBL157091 Peptide deformylase Escherichia coli 3 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137318 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137318&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 9844927 104027484 CHEMBL157091 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024901 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(F)cc1 InChI=1S/C22H31FN2O4/c1-22(2,3)20(19(27)16-8-10-18(23)11-9-16)24-21(28)17(13-25(29)14-26)12-15-6-4-5-7-15/h8-11,14-15,17,20,29H,4-7,12-13H2,1-3H3,(H,24,28) OIYNYPJATHVIMQ-UHFFFAOYSA-N 50137346 (R)-2-Cyclopentylmethyl-N-[(S)-1-(4-fluoro-benzoyl)-2,2-dimethyl-propyl]-3-(formyl-hydroxy-amino)-propionamide::CHEMBL157797 Peptide deformylase Escherichia coli 3 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137346 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137346&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 21305230 104027512 CHEMBL157797 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024902 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccc(cc1)C#N)C(C)(C)C InChI=1S/C21H29N3O4/c1-5-6-7-17(13-24(28)14-25)20(27)23-19(21(2,3)4)18(26)16-10-8-15(12-22)9-11-16/h8-11,14,17,19,28H,5-7,13H2,1-4H3,(H,23,27) UQNRUULZGWBZMV-UHFFFAOYSA-N 50137344 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-1-(4-cyano-benzoyl)-2,2-dimethyl-propyl]-amide::CHEMBL422175 Peptide deformylase Escherichia coli 7 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137344 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137344&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371541 104027510 CHEMBL422175 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024903 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)N(C)C)C(C)(C)C InChI=1S/C16H31N3O4/c1-7-8-9-12(10-19(23)11-20)14(21)17-13(16(2,3)4)15(22)18(5)6/h11-13,23H,7-10H2,1-6H3,(H,17,21) AVDLWYHBABSSHC-UHFFFAOYSA-N 50104501 BB-3497::(R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid (1-dimethylcarbamoyl-2,2-dimethyl-propyl)-amide::2-[(FORMYL-HYDROXY-AMINO)-METHYL]-HEXANOIC ACID (1-DIMETHYLCARBAMOYL-2,2-DIMETHYL-PROPYL)-AMIDE::(R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid ((S)-1-dimethylcarbamoyl-2-methyl-2-methyl-propyl)-amide::(R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid ((S)-1-dimethylcarbamoyl-2,2-dimethyl-propyl)-amide::(R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [1-((S)-dimethyl-carbamoyl)-2,2-dimethyl-propyl]-amide::CHEMBL431210 Peptide deformylase Escherichia coli 7 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50104501 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50104501&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 159596 104000439 CHEMBL431210 DB04368 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024904 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(cc1)N1CCC[C@H]1CO InChI=1S/C27H41N3O5/c1-27(2,3)25(28-26(34)21(16-29(35)18-32)15-19-7-4-5-8-19)24(33)20-10-12-22(13-11-20)30-14-6-9-23(30)17-31/h10-13,18-19,21,23,25,31,35H,4-9,14-17H2,1-3H3,(H,28,34) IOWWIYCWRORSBJ-UHFFFAOYSA-N 50137338 (R)-2-Cyclopentylmethyl-3-(formyl-hydroxy-amino)-N-{(S)-1-[4-((S)-2-hydroxymethyl-pyrrolidin-1-yl)-benzoyl]-2,2-dimethyl-propyl}-propionamide::CHEMBL160513 Peptide deformylase Escherichia coli 7 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137338 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137338&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371263 104027504 CHEMBL160513 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024905 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccc(NC(C)=O)cc1)C(C)(C)C InChI=1S/C22H33N3O5/c1-6-7-8-17(13-25(30)14-26)21(29)24-20(22(3,4)5)19(28)16-9-11-18(12-10-16)23-15(2)27/h9-12,14,17,20,30H,6-8,13H2,1-5H3,(H,23,27)(H,24,29) UEGKVENTYLHBKA-UHFFFAOYSA-N 50137325 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-1-(4-acetylamino-benzoyl)-2,2-dimethyl-propyl]-amide::CHEMBL157712 Peptide deformylase Escherichia coli 8 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137325 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137325&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 21305220 104027491 CHEMBL157712 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024906 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccc(cc1)N1CCOCC1)C(C)(C)C InChI=1S/C24H37N3O5/c1-5-6-7-19(16-27(31)17-28)23(30)25-22(24(2,3)4)21(29)18-8-10-20(11-9-18)26-12-14-32-15-13-26/h8-11,17,19,22,31H,5-7,12-16H2,1-4H3,(H,25,30) RMFDZNQYKLNRBN-UHFFFAOYSA-N 50137331 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-2,2-dimethyl-1-(4-morpholin-4-yl-benzoyl)-propyl]-amide::CHEMBL160493 Peptide deformylase Escherichia coli 5 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137331 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137331&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371401 104027497 CHEMBL160493 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024907 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(N2CCN(CCN3CCCC3)CC2)c(F)c1 InChI=1S/C32H50FN5O4/c1-32(2,3)30(34-31(41)26(22-38(42)23-39)20-24-8-4-5-9-24)29(40)25-10-11-28(27(33)21-25)37-18-16-36(17-19-37)15-14-35-12-6-7-13-35/h10-11,21,23-24,26,30,42H,4-9,12-20,22H2,1-3H3,(H,34,41) QEJZIIPTGOUQDA-UHFFFAOYSA-N 50137322 (R)-2-Cyclopentylmethyl-N-((S)-1-{3-fluoro-4-[4-(2-pyrrolidin-1-yl-ethyl)-piperazin-1-yl]-benzoyl}-2,2-dimethyl-propyl)-3-(formyl-hydroxy-amino)-propionamide::CHEMBL157687 Peptide deformylase Escherichia coli 9 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137322 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137322&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371352 104027488 CHEMBL157687 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024908 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(cc1)N1CCOCC1 InChI=1S/C26H39N3O5/c1-26(2,3)24(23(31)20-8-10-22(11-9-20)28-12-14-34-15-13-28)27-25(32)21(17-29(33)18-30)16-19-6-4-5-7-19/h8-11,18-19,21,24,33H,4-7,12-17H2,1-3H3,(H,27,32) UWKPTCMEPRANIC-UHFFFAOYSA-N 50137317 (R)-2-Cyclopentylmethyl-N-[(S)-2,2-dimethyl-1-(4-morpholin-4-yl-benzoyl)-propyl]-3-(formyl-hydroxy-amino)-propionamide::CHEMBL348888 Peptide deformylase Escherichia coli 6.00 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137317 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137317&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371409 104027483 CHEMBL348888 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024909 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccc(NS(C)(=O)=O)cc1)C(C)(C)C InChI=1S/C21H33N3O6S/c1-6-7-8-16(13-24(28)14-25)20(27)22-19(21(2,3)4)18(26)15-9-11-17(12-10-15)23-31(5,29)30/h9-12,14,16,19,23,28H,6-8,13H2,1-5H3,(H,22,27) XYOXHBUOCWDPAP-UHFFFAOYSA-N 50137347 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-1-(4-methanesulfonylamino-benzoyl)-2,2-dimethyl-propyl]-amide::CHEMBL155998 Peptide deformylase Escherichia coli 4 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137347 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137347&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 21305224 104027513 CHEMBL155998 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024910 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1cc(F)c(F)cc1N1CCN(CCN2CCCC2)CC1 InChI=1S/C32H49F2N5O4/c1-32(2,3)30(35-31(42)24(21-39(43)22-40)18-23-8-4-5-9-23)29(41)25-19-26(33)27(34)20-28(25)38-16-14-37(15-17-38)13-12-36-10-6-7-11-36/h19-20,22-24,30,43H,4-18,21H2,1-3H3,(H,35,42) IYCBWGNILAJQQO-UHFFFAOYSA-N 50137316 (R)-2-Cyclopentylmethyl-N-((S)-1-{4,5-difluoro-2-[4-(2-pyrrolidin-1-yl-ethyl)-piperazin-1-yl]-benzoyl}-2,2-dimethyl-propyl)-3-(formyl-hydroxy-amino)-propionamide::CHEMBL347445 Peptide deformylase Escherichia coli 2 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137316 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137316&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371351 104027482 CHEMBL347445 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024911 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1cc(F)c(F)cc1N1CCOCC1 InChI=1S/C26H37F2N3O5/c1-26(2,3)24(29-25(34)18(15-31(35)16-32)12-17-6-4-5-7-17)23(33)19-13-20(27)21(28)14-22(19)30-8-10-36-11-9-30/h13-14,16-18,24,35H,4-12,15H2,1-3H3,(H,29,34) VRBTYGBBFHOEHU-UHFFFAOYSA-N 50137332 (R)-2-Cyclopentylmethyl-N-[(S)-1-(4,5-difluoro-2-morpholin-4-yl-benzoyl)-2,2-dimethyl-propyl]-3-(formyl-hydroxy-amino)-propionamide::CHEMBL156257 Peptide deformylase Escherichia coli 0.500000 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137332 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137332&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 10255739 104027498 CHEMBL156257 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024912 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1cc(F)c(F)cc1N1CCN(CCN2CCOCC2)CC1 InChI=1S/C32H49F2N5O5/c1-32(2,3)30(35-31(42)24(21-39(43)22-40)18-23-6-4-5-7-23)29(41)25-19-26(33)27(34)20-28(25)38-12-10-36(11-13-38)8-9-37-14-16-44-17-15-37/h19-20,22-24,30,43H,4-18,21H2,1-3H3,(H,35,42) WLMBFUAQPCCEBO-UHFFFAOYSA-N 50137329 (R)-2-Cyclopentylmethyl-N-((S)-1-{4,5-difluoro-2-[4-(2-morpholin-4-yl-ethyl)-piperazin-1-yl]-benzoyl}-2,2-dimethyl-propyl)-3-(formyl-hydroxy-amino)-propionamide::CHEMBL347977 Peptide deformylase Escherichia coli 2 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137329 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137329&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371572 104027495 CHEMBL347977 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024913 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(N2CCN(CCN3CCOCC3)CC2)c(F)c1 InChI=1S/C32H50FN5O5/c1-32(2,3)30(34-31(41)26(22-38(42)23-39)20-24-6-4-5-7-24)29(40)25-8-9-28(27(33)21-25)37-14-12-35(13-15-37)10-11-36-16-18-43-19-17-36/h8-9,21,23-24,26,30,42H,4-7,10-20,22H2,1-3H3,(H,34,41) CTEVYPNDEWWZDP-UHFFFAOYSA-N 50137337 (R)-2-Cyclopentylmethyl-N-((S)-1-{3-fluoro-4-[4-(2-morpholin-4-yl-ethyl)-piperazin-1-yl]-benzoyl}-2,2-dimethyl-propyl)-3-(formyl-hydroxy-amino)-propionamide::CHEMBL350211 Peptide deformylase Escherichia coli 6 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137337 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137337&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371275 104027503 CHEMBL350211 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024914 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccccc1)C(C)(C)C InChI=1S/C20H30N2O4/c1-5-6-10-16(13-22(26)14-23)19(25)21-18(20(2,3)4)17(24)15-11-8-7-9-12-15/h7-9,11-12,14,16,18,26H,5-6,10,13H2,1-4H3,(H,21,25) SEWKIBJOBYMVII-UHFFFAOYSA-N 50137330 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid ((S)-1-benzoyl-2,2-dimethyl-propyl)-amide::CHEMBL154703 Peptide deformylase Escherichia coli 3 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137330 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137330&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 21305226 104027496 CHEMBL154703 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024915 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccc(OC)cc1)C(C)(C)C InChI=1S/C21H32N2O5/c1-6-7-8-16(13-23(27)14-24)20(26)22-19(21(2,3)4)18(25)15-9-11-17(28-5)12-10-15/h9-12,14,16,19,27H,6-8,13H2,1-5H3,(H,22,26) JDATXQDDINQWAX-UHFFFAOYSA-N 50137345 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-1-(4-methoxy-benzoyl)-2,2-dimethyl-propyl]-amide::CHEMBL156033 Peptide deformylase Escherichia coli 1 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137345 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137345&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371468 104027511 CHEMBL156033 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024916 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(cc1)N1CCC(O)CC1 InChI=1S/C27H41N3O5/c1-27(2,3)25(28-26(34)21(17-30(35)18-31)16-19-6-4-5-7-19)24(33)20-8-10-22(11-9-20)29-14-12-23(32)13-15-29/h8-11,18-19,21,23,25,32,35H,4-7,12-17H2,1-3H3,(H,28,34) DWULSZURVYGTIB-UHFFFAOYSA-N 50137339 (R)-2-Cyclopentylmethyl-3-(formyl-hydroxy-amino)-N-{(S)-1-[4-(4-hydroxy-piperidin-1-yl)-benzoyl]-2,2-dimethyl-propyl}-propionamide::CHEMBL157738 Peptide deformylase Escherichia coli 2 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137339 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137339&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371546 104027505 CHEMBL157738 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024917 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1cc(F)c(F)cc1N1CCN(CCO)CC1 InChI=1S/C28H42F2N4O5/c1-28(2,3)26(31-27(38)20(17-34(39)18-36)14-19-6-4-5-7-19)25(37)21-15-22(29)23(30)16-24(21)33-10-8-32(9-11-33)12-13-35/h15-16,18-20,26,35,39H,4-14,17H2,1-3H3,(H,31,38) GNMHZXHBDNRMPA-UHFFFAOYSA-N 50137342 (R)-2-Cyclopentylmethyl-N-((S)-1-{4,5-difluoro-2-[4-(2-hydroxy-ethyl)-piperazin-1-yl]-benzoyl}-2,2-dimethyl-propyl)-3-(formyl-hydroxy-amino)-propionamide::CHEMBL345440 Peptide deformylase Escherichia coli 2 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137342 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137342&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371790 104027508 CHEMBL345440 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024918 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(cc1)N1CCN(CCO)CC1 InChI=1S/C28H44N4O5/c1-28(2,3)26(29-27(36)23(19-32(37)20-34)18-21-6-4-5-7-21)25(35)22-8-10-24(11-9-22)31-14-12-30(13-15-31)16-17-33/h8-11,20-21,23,26,33,37H,4-7,12-19H2,1-3H3,(H,29,36) NWFJDVCPFVFLHP-UHFFFAOYSA-N 50137326 (R)-2-Cyclopentylmethyl-3-(formyl-hydroxy-amino)-N-((S)-1-{4-[4-(2-hydroxy-ethyl)-piperazin-1-yl]-benzoyl}-2,2-dimethyl-propyl)-propionamide::CHEMBL156187 Peptide deformylase Escherichia coli 2 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137326 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137326&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371534 104027492 CHEMBL156187 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024919 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccc(NC(=O)C(F)(F)F)cc1)C(C)(C)C InChI=1S/C22H30F3N3O5/c1-5-6-7-15(12-28(33)13-29)19(31)27-18(21(2,3)4)17(30)14-8-10-16(11-9-14)26-20(32)22(23,24)25/h8-11,13,15,18,33H,5-7,12H2,1-4H3,(H,26,32)(H,27,31) DLGLQUCPQJCPRR-UHFFFAOYSA-N 50137343 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid {(S)-2,2-dimethyl-1-[4-(2,2,2-trifluoro-acetylamino)-benzoyl]-propyl}-amide::CHEMBL423047 Peptide deformylase Escherichia coli 20 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137343 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137343&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371435 104027509 CHEMBL423047 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024920 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(cc1)N1CCN(CCN2CCOCC2)CC1 InChI=1S/C32H51N5O5/c1-32(2,3)30(33-31(40)27(23-37(41)24-38)22-25-6-4-5-7-25)29(39)26-8-10-28(11-9-26)36-16-14-34(15-17-36)12-13-35-18-20-42-21-19-35/h8-11,24-25,27,30,41H,4-7,12-23H2,1-3H3,(H,33,40) GNKDAFHMMHAYTA-UHFFFAOYSA-N 50137334 (R)-2-Cyclopentylmethyl-N-((S)-2,2-dimethyl-1-{4-[4-(2-morpholin-4-yl-ethyl)-piperazin-1-yl]-benzoyl}-propyl)-3-(formyl-hydroxy-amino)-propionamide::CHEMBL346291 Peptide deformylase Escherichia coli 2 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137334 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137334&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371345 104027500 CHEMBL346291 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024921 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1cc2ccccc2o1)C(C)(C)C InChI=1S/C22H30N2O5/c1-5-6-9-16(13-24(28)14-25)21(27)23-20(22(2,3)4)19(26)18-12-15-10-7-8-11-17(15)29-18/h7-8,10-12,14,16,20,28H,5-6,9,13H2,1-4H3,(H,23,27) KUVBYZUUYDILIE-UHFFFAOYSA-N 50137313 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-1-(benzofuran-2-carbonyl)-2,2-dimethyl-propyl]-amide::CHEMBL156543 Peptide deformylase Escherichia coli 4 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137313 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137313&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 21305225 104027479 CHEMBL156543 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024922 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(N2CCOCC2)c(F)c1 InChI=1S/C26H38FN3O5/c1-26(2,3)24(28-25(33)20(16-30(34)17-31)14-18-6-4-5-7-18)23(32)19-8-9-22(21(27)15-19)29-10-12-35-13-11-29/h8-9,15,17-18,20,24,34H,4-7,10-14,16H2,1-3H3,(H,28,33) TZNAAILVEGIFET-UHFFFAOYSA-N 50137327 (R)-2-Cyclopentylmethyl-N-[(S)-1-(3-fluoro-4-morpholin-4-yl-benzoyl)-2,2-dimethyl-propyl]-3-(formyl-hydroxy-amino)-propionamide::CHEMBL156414 Peptide deformylase Escherichia coli 0.600000 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137327 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137327&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371505 104027493 CHEMBL156414 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024923 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(cc1)S(C)(=O)=O InChI=1S/C23H34N2O6S/c1-23(2,3)21(20(27)17-9-11-19(12-10-17)32(4,30)31)24-22(28)18(14-25(29)15-26)13-16-7-5-6-8-16/h9-12,15-16,18,21,29H,5-8,13-14H2,1-4H3,(H,24,28) LKBISSMUJCUZTF-UHFFFAOYSA-N 50137321 (R)-2-Cyclopentylmethyl-3-(formyl-hydroxy-amino)-N-[(S)-1-(4-methanesulfonyl-benzoyl)-2,2-dimethyl-propyl]-propionamide::CHEMBL156080 Peptide deformylase Escherichia coli 10 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137321 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137321&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371520 104027487 CHEMBL156080 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024924 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(O)cc1 InChI=1S/C22H32N2O5/c1-22(2,3)20(19(27)16-8-10-18(26)11-9-16)23-21(28)17(13-24(29)14-25)12-15-6-4-5-7-15/h8-11,14-15,17,20,26,29H,4-7,12-13H2,1-3H3,(H,23,28) QXTFDCFNCIKKMU-UHFFFAOYSA-N 50137328 (R)-2-Cyclopentylmethyl-3-(formyl-hydroxy-amino)-N-[(S)-1-(4-hydroxy-benzoyl)-2,2-dimethyl-propyl]-propionamide::CHEMBL156547 Peptide deformylase Escherichia coli 2 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137328 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137328&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371734 104027494 CHEMBL156547 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024925 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccc(N)cc1)C(C)(C)C InChI=1S/C20H31N3O4/c1-5-6-7-15(12-23(27)13-24)19(26)22-18(20(2,3)4)17(25)14-8-10-16(21)11-9-14/h8-11,13,15,18,27H,5-7,12,21H2,1-4H3,(H,22,26) WJAIMIARAXUMSU-UHFFFAOYSA-N 50137336 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-1-(4-amino-benzoyl)-2,2-dimethyl-propyl]-amide::CHEMBL346544 Peptide deformylase Escherichia coli 8 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137336 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137336&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 21305221 104027502 CHEMBL346544 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024926 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1cc2ccccc2o1 InChI=1S/C24H32N2O5/c1-24(2,3)22(21(28)20-13-17-10-6-7-11-19(17)31-20)25-23(29)18(14-26(30)15-27)12-16-8-4-5-9-16/h6-7,10-11,13,15-16,18,22,30H,4-5,8-9,12,14H2,1-3H3,(H,25,29) LFAWHRYUVJKCAJ-UHFFFAOYSA-N 50137335 (R)-N-[(S)-1-(Benzofuran-2-carbonyl)-2,2-dimethyl-propyl]-2-cyclopentylmethyl-3-(formyl-hydroxy-amino)-propionamide::CHEMBL156546 Peptide deformylase Escherichia coli 4 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137335 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137335&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 21305232 104027501 CHEMBL156546 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024927 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccc(O)cc1)C(C)(C)C InChI=1S/C20H30N2O5/c1-5-6-7-15(12-22(27)13-23)19(26)21-18(20(2,3)4)17(25)14-8-10-16(24)11-9-14/h8-11,13,15,18,24,27H,5-7,12H2,1-4H3,(H,21,26) GUFNCNYRHRLJQO-UHFFFAOYSA-N 50137315 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-1-(4-hydroxy-benzoyl)-2,2-dimethyl-propyl]-amide::CHEMBL347418 Peptide deformylase Escherichia coli 8 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137315 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137315&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371735 104027481 CHEMBL347418 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024928 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccc(F)cc1)C(C)(C)C InChI=1S/C20H29FN2O4/c1-5-6-7-15(12-23(27)13-24)19(26)22-18(20(2,3)4)17(25)14-8-10-16(21)11-9-14/h8-11,13,15,18,27H,5-7,12H2,1-4H3,(H,22,26) REGHPMOIWHOLII-UHFFFAOYSA-N 50137348 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-1-(4-fluoro-benzoyl)-2,2-dimethyl-propyl]-amide::CHEMBL156201 Peptide deformylase Escherichia coli 3 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137348 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137348&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 21305223 104027514 CHEMBL156201 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024929 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1cc(F)c(F)cc1N1CCC[C@H]1CO InChI=1S/C27H39F2N3O5/c1-27(2,3)25(30-26(36)18(14-31(37)16-34)11-17-7-4-5-8-17)24(35)20-12-21(28)22(29)13-23(20)32-10-6-9-19(32)15-33/h12-13,16-19,25,33,37H,4-11,14-15H2,1-3H3,(H,30,36) LGPFPZQLKIZTPW-UHFFFAOYSA-N 50137320 (R)-2-Cyclopentylmethyl-N-{(S)-1-[4,5-difluoro-2-((S)-2-hydroxymethyl-pyrrolidin-1-yl)-benzoyl]-2,2-dimethyl-propyl}-3-(formyl-hydroxy-amino)-propionamide::CHEMBL346581 Peptide deformylase Escherichia coli 2 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137320 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137320&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371339 104027486 CHEMBL346581 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50024930 CCCC[C@H](CN(O)C=O)C(=O)N[C@H](C(=O)c1ccccn1)C(C)(C)C InChI=1S/C19H29N3O4/c1-5-6-9-14(12-22(26)13-23)18(25)21-17(19(2,3)4)16(24)15-10-7-8-11-20-15/h7-8,10-11,13-14,17,26H,5-6,9,12H2,1-4H3,(H,21,25) NGFKLEMUGMVHAI-UHFFFAOYSA-N 50137319 (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [(S)-2,2-dimethyl-1-(pyridine-2-carbonyl)-propyl]-amide::CHEMBL156427 Peptide deformylase Escherichia coli 3 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137319 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137319&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 21305229 104027485 CHEMBL156427 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24 50595045 CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(cc1)N1CCOCC1 InChI=1S/C26H39N3O5/c1-26(2,3)24(23(31)20-8-10-22(11-9-20)28-12-14-34-15-13-28)27-25(32)21(17-29(33)18-30)16-19-6-4-5-7-19/h8-11,18-19,21,24,33H,4-7,12-17H2,1-3H3,(H,27,32) UWKPTCMEPRANIC-UHFFFAOYSA-N 50137317 (R)-2-Cyclopentylmethyl-N-[(S)-2,2-dimethyl-1-(4-morpholin-4-yl-benzoyl)-propyl]-3-(formyl-hydroxy-amino)-propionamide::CHEMBL348888 Peptide deformylase Escherichia coli 6 ChEMBL 10.1016/j.bmcl.2003.10.013 10.7270/Q2T43SHT 14684298 East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M 12/19/2003 11/10/2009 British Biotech Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50137317 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000051&target=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50137317&enzyme=Peptide+deformylase&column=ki&startPg=0&Increment=50&submit=Search 44371409 104027483 CHEMBL348888 1 MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIGLRLGNGKYCTLRLFFNQV Peptide deformylase-like Q9JN24_ECOLX Q9JN24