BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 13352 c1ccc2c(c1)[nH]cn2 InChI=1S/C7H6N2/c1-2-4-7-6(3-1)8-5-9-7/h1-5H,(H,8,9) HYZJCKYKOHLVJF-UHFFFAOYSA-N 7939 1H-1,3-benzodiazole::Benzimidazole::Benzimidazole (Blm)::US9138393, Benzimidazole::US9144538, Benzimidazole Glutaminyl-peptide cyclotransferase Homo sapiens 138000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7939 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7939&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search BZI 4DSU,7KYT,4HPX,4XV5,4XVA,7KXC,1KXM,5K1L,1RYC,9BNJ,7LGX,6X0C,1L5F,7MT6,5PHK,4NVE 5798 11108701 C02009 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13355 C=Cn1ccnc1 InChI=1S/C5H6N2/c1-2-7-4-3-6-5-7/h2-5H,1H2 OSSNTDFYBPYIEC-UHFFFAOYSA-N 7942 1-ethenyl-1H-imidazole::1-Subsituted 1H-imidazole, 8::1-Vinylimidazole::Imidazole N-1 deriv. 3::US9138393, 1-Vinylimidazole::US9144538, 1-Vinylimidazole Glutaminyl-peptide cyclotransferase Homo sapiens 49000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7942 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7942&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 66171 11108704 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13357 CC(=O)n1ccnc1 InChI=1S/C5H6N2O/c1-5(8)7-3-2-6-4-7/h2-4H,1H3 VIHYIVKEECZGOU-UHFFFAOYSA-N 7944 N-Acetylimidazole::1-(1H-imidazol-1-yl)ethan-1-one::Imidazole N-1 deriv. 5::US9138393, 1- Acetylimidazole::US9144538, 1-Acetylimidazole Glutaminyl-peptide cyclotransferase Homo sapiens 107000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7944 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7944&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 6EX 5IXX 17174 11108705 C02560 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13358 C[Si](C)(C)n1ccnc1 InChI=1S/C6H12N2Si/c1-9(2,3)8-5-4-7-6-8/h4-6H,1-3H3 YKFRUJSEPGHZFJ-UHFFFAOYSA-N 7945 N-(Trimethylsilyl)-imidazole::1-(trimethylsilyl)-1H-imidazole::Imidazole N-1 deriv. 6 Glutaminyl-peptide cyclotransferase Homo sapiens 167000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7945 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7945&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 28925 11108706 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13359 O=C(c1ccccc1)n1ccnc1 InChI=1S/C10H8N2O/c13-10(12-7-6-11-8-12)9-4-2-1-3-5-9/h1-8H JEGIFBGJZPYMJS-UHFFFAOYSA-N 7946 N-Benzoylimidazole::1-benzoyl-1H-imidazole::Imidazole N-1 deriv. 7 Glutaminyl-peptide cyclotransferase Homo sapiens 174000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7946 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7946&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 66319 11108707 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13360 O=C(Cn1ccnc1)c1ccccc1 InChI=1S/C11H10N2O/c14-11(8-13-7-6-12-9-13)10-4-2-1-3-5-10/h1-7,9H,8H2 CVJNXVLQSKPUGP-UHFFFAOYSA-N 7947 1-(2-Oxo-2-phenylethyl)-imidazole::2-(1H-imidazol-1-yl)-1-phenylethan-1-one::Imidazole N-1 deriv. 8 Glutaminyl-peptide cyclotransferase Homo sapiens 184000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7947 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7947&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 32235 11108708 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13361 NCCCn1ccnc1 InChI=1S/C6H11N3/c7-2-1-4-9-5-3-8-6-9/h3,5-6H,1-2,4,7H2 KDHWOCLBMVSZPG-UHFFFAOYSA-N 7948 1-(3-Aminopropyl)-imidazole::3-(1H-imidazol-1-yl)propan-1-amine::Imidazole N-1 deriv. 9::US9138393, N-(3- Aminopropyl) imidazole::US9144538, N-(3-Aminopropyl) imidazole Glutaminyl-peptide cyclotransferase Homo sapiens 410000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7948 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7948&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 78736 11108709 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13362 CC(=O)NCCc1cnc[nH]1 InChI=1S/C7H11N3O/c1-6(11)9-3-2-7-4-8-5-10-7/h4-5H,2-3H2,1H3,(H,8,10)(H,9,11) XJWPISBUKWZALE-UHFFFAOYSA-N 7949 N-[2-(1H-Imidazol-4-yl)ethyl]acetamide::N-omega-Acetylhistamine::N-w-acetylhistamine (AH)::Imidazole C-4(5) deriv. 1 Glutaminyl-peptide cyclotransferase Homo sapiens 17000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7949 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7949&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 69602 11108710 DB04622 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13363 N[C@@H](Cc1cnc[nH]1)C(N)=O |r| InChI=1S/C6H10N4O/c7-5(6(8)11)1-4-2-9-3-10-4/h2-3,5H,1,7H2,(H2,8,11)(H,9,10) UMMQVDUMUMBTAV-UHFFFAOYSA-N 7950 L-Histidinamide::(2S)-2-amino-3-(1H-imidazol-4-yl)propanamide::Imidazole C-4(5) deriv. 2 Glutaminyl-peptide cyclotransferase Homo sapiens 560000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7950 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7950&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 445697 11108711 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13364 NC(Cc1cnc[nH]1)C(=O)NC(Cc1c[nH]c2ccccc12)C(O)=O InChI=1S/C17H19N5O3/c18-13(6-11-8-19-9-21-11)16(23)22-15(17(24)25)5-10-7-20-14-4-2-1-3-12(10)14/h1-4,7-9,13,15,20H,5-6,18H2,(H,19,21)(H,22,23)(H,24,25) FBTYOQIYBULKEH-UHFFFAOYSA-N 7951 H-His-Trp-OH::2-[2-amino-3-(1H-imidazol-4-yl)propanamido]-3-(1H-indol-3-yl)propanoic acid::Imidazole C-4(5) deriv. 3 Glutaminyl-peptide cyclotransferase Homo sapiens 600000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7951 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7951&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 6539217 11108712 C00107 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13365 N[C@H](CO)Cc1cnc[nH]1 |r| InChI=1S/C6H11N3O/c7-5(3-10)1-6-2-8-4-9-6/h2,4-5,10H,1,3,7H2,(H,8,9) ZQISRDCJNBUVMM-UHFFFAOYSA-N 7952 (2S)-2-amino-3-(1H-imidazol-4-yl)propan-1-ol::L-Histidinol::Imidazole C-4(5) deriv. 4 Glutaminyl-peptide cyclotransferase Homo sapiens 1530000 8.0000 30.00 C Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7952 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7952&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 165271 11108713 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13366 N[C@@H](Cc1cnc[nH]1)C(O)=O |r| InChI=1S/C6H9N3O2/c7-5(6(10)11)1-4-2-8-3-9-4/h2-3,5H,1,7H2,(H,8,9)(H,10,11) HNDVDQJCIGZPNO-UHFFFAOYSA-N 7953 L-2-Amino-3-(4-imidazolyl)propionic acid::(2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid::L-Histidine::Imidazole C-4(5) deriv. 5::Histidine Glutaminyl-peptide cyclotransferase Homo sapiens 4400000 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7953 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7953&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 6274 11108714 DB00117 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13367 O=Cc1cnc[nH]1 InChI=1S/C4H4N2O/c7-2-4-1-5-3-6-4/h1-3H,(H,5,6) ZQEXIXXJFSQPNA-UHFFFAOYSA-N 7954 Imidazole-4-carboxaldehyde::1H-imidazole-4-carbaldehyde::4-Imidazole-carboxaldehyde::Imidazole C-4(5) deriv. 6 Glutaminyl-peptide cyclotransferase Homo sapiens 7600000 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7954 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7954&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 76428 11108715 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13368 COC(=O)c1cnc[nH]1 InChI=1S/C5H6N2O2/c1-9-5(8)4-2-6-3-7-4/h2-3H,1H3,(H,6,7) DVLGIQNHKLWSRU-UHFFFAOYSA-N 7955 Imidazol-4-carbonic acid methylester::methyl 1H-imidazole-4-carboxylate::Imidazole C-4(5) deriv. 7 Glutaminyl-peptide cyclotransferase Homo sapiens 14500000 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7955 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7955&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 565661 11108716 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13369 Cc1nc[nH]c1CO InChI=1S/C5H8N2O/c1-4-5(2-8)7-3-6-4/h3,8H,2H2,1H3,(H,6,7) AXJZCJSXNZZMDU-UHFFFAOYSA-N 7956 (4-methyl-1H-imidazol-5-yl)methanol::5-Hydroxymethyl-4-methyl-imidazole::Imidazole C-4,5 deriv. 1 Glutaminyl-peptide cyclotransferase Homo sapiens 129000 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7956 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7956&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 122433 11108717 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13370 NC(=O)c1[nH]cnc1N InChI=1S/C4H6N4O/c5-3-2(4(6)9)7-1-8-3/h1H,5H2,(H2,6,9)(H,7,8) DVNYTAVYBRSTGK-UHFFFAOYSA-N 7957 5-Amino-3H-imidazole-4-carboxylic acid amide::4-amino-1H-imidazole-5-carboxamide::Imidazole C-4,5 deriv. 2 Glutaminyl-peptide cyclotransferase Homo sapiens 15500000 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7957 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7957&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 9679 11108718 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13372 CCc1ncc(C)[nH]1 InChI=1S/C6H10N2/c1-3-6-7-4-5(2)8-6/h4H,3H2,1-2H3,(H,7,8) ULKLGIFJWFIQFF-UHFFFAOYSA-N 7959 2-ethyl-4-methyl-1H-imidazole::2-Ethyl-4-methyl-imidazole::Imidazole C-2 deriv. 2 Glutaminyl-peptide cyclotransferase Homo sapiens 580000 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7959 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7959&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 70262 11108720 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13373 c1ccc2c(c1)[nH]c(n2)N InChI=1S/C7H7N3/c8-7-9-5-3-1-2-4-6(5)10-7/h1-4H,(H3,8,9,10) JWYUFVNJZUSCSM-UHFFFAOYSA-N 7960 CHEMBL305513::JMC524454 Compound 5::1H-1,3-benzodiazol-2-amine::CRA Fragment 9::2-Aminobenzimidazole::Imidazole C-2 deriv. 3::US11584714, Compound 46::US12195427, Compound 46 Glutaminyl-peptide cyclotransferase Homo sapiens 1800000 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7960 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7960&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search AX7 5Z4O,5Z4H,6EQ5,7DQS,7DQH,7DQL,7DQM,5SWG,7DQW,7DQU,5Z9F,5Z9E,5Z9B,5Z9L,5Z9P,5Z9Q,7DQI,7DQF,7DQJ,3KQS,5PAR,3GN1,7DPR,7DPS,7DOR 13624 11108721 CHEMBL305513 C10901 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13374 C(CCCn1ccnc1)CCOc1ccccc1 InChI=1S/C15H20N2O/c1(6-11-17-12-10-16-14-17)2-7-13-18-15-8-4-3-5-9-15/h3-5,8-10,12,14H,1-2,6-7,11,13H2 JMCVLVYSZPTSRJ-UHFFFAOYSA-N 7961 1-(6-phenoxyhexyl)-1H-imidazole::Imidazole N-1 deriv. 12 Glutaminyl-peptide cyclotransferase Homo sapiens 6200 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7961 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7961&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 3776215 11108722 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13375 OC(=O)c1ccc(OCCn2ccnc2)cc1 InChI=1S/C12H12N2O3/c15-12(16)10-1-3-11(4-2-10)17-8-7-14-6-5-13-9-14/h1-6,9H,7-8H2,(H,15,16) XQGZSYKGWHUSDH-UHFFFAOYSA-N 7962 CHEMBL537708::4-[2-(1H-imidazol-1-yl)ethoxy]benzoic acid::4-(2-imidazol-1-yl-ethoxy)-benzoic acid::CHEMBL267473::4-(2-Imidazol-1-yl-ethoxy)-benzoic acid; hydrochloride::Imidazole N-1 deriv. 13::dazoxiben Glutaminyl-peptide cyclotransferase Homo sapiens 2300 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7962 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7962&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 53001 11108723 CHEMBL267473CHEMBL537708 DB03052 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13376 Clc1ccc(NC(=S)NCCn2ccnc2)cc1 InChI=1S/C12H13ClN4S/c13-10-1-3-11(4-2-10)16-12(18)15-6-8-17-7-5-14-9-17/h1-5,7,9H,6,8H2,(H2,15,16,18) XLEXEEKSLVUKTI-UHFFFAOYSA-N 7963 1-(4-chlorophenyl)-3-[2-(1H-imidazol-1-yl)ethyl]thiourea::N-(4-chlorophenyl)-N-[2-(1H-imidazol-1-yl)ethyl]thiourea::Imidazole N-1 deriv. 14 Glutaminyl-peptide cyclotransferase Homo sapiens 1200 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7963 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7963&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 2798590 11108724 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13378 Cc1cc(Cn2ccnc2)c(C)cc1Cn1ccnc1 InChI=1S/C16H18N4/c1-13-7-16(10-20-6-4-18-12-20)14(2)8-15(13)9-19-5-3-17-11-19/h3-8,11-12H,9-10H2,1-2H3 NYAUDKLEAIYMOH-UHFFFAOYSA-N 7965 1,4-bis-(imidazol-1-yl)methyl-2,5-dimethylbenzene::1-{[4-(1H-imidazol-1-ylmethyl)-2,5-dimethylphenyl]methyl}-1H-imidazole::Imidazole N-1 deriv. 16 Glutaminyl-peptide cyclotransferase Homo sapiens 295 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7965 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7965&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 658311 11108726 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13379 NCCc1cnc[nH]1 InChI=1S/C5H9N3/c6-2-1-5-3-7-4-8-5/h3-4H,1-2,6H2,(H,7,8) NTYJJOPFIAHURM-UHFFFAOYSA-N 7966 [3H]histamine::2-(1H-imidazol-4-yl)ethan-1-amine::CHEMBL544208::Histamine::HISTAMINE DIHYDROCHLORIDE::Peremin::Ceplene::L-histamine::Ergotidine::CHEMBL90 Glutaminyl-peptide cyclotransferase Homo sapiens 850000 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7966 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7966&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 774 11108702 CHEMBL90CHEMBL544208 DB00667 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 13380 Cn1cncc1CCN InChI=1S/C6H11N3/c1-9-5-8-4-6(9)2-3-7/h4-5H,2-3,7H2,1H3 CPAGZVLINCPJEH-UHFFFAOYSA-N 7967 CHEMBL14722::2-(1-methyl-1H-imidazol-5-yl)ethan-1-amine::1-methyl-5-(beta-aminoethyl)-imidazole::L-histamine deriv. 1 Glutaminyl-peptide cyclotransferase Homo sapiens 120000 Curated from the literature by BindingDB 10.1074/jbc.M309077200 10.7270/Q2513WDS 14522962 aid1796109 Schilling, S; Niestroj, AJ; Rahfeld, JU; Hoffmann, T; Wermann, M; Zunkel, K; Wasternack, C; Demuth, HU 12/12/2003 2/28/2006 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7967 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7967&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 69520 11108703 CHEMBL14722 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4