BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50021842 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNCc2ccccc2OC)c1=O InChI=1S/C30H31F2N3O4/c1-19(16-33-17-22-9-5-6-14-27(22)39-4)35-29(36)28(21-10-7-11-23(15-21)38-3)20(2)34(30(35)37)18-24-25(31)12-8-13-26(24)32/h5-15,19,33H,16-18H2,1-4H3 QUAHGERGEDVAKS-UHFFFAOYSA-N 50132755 1-(2,6-Difluoro-benzyl)-3-[(R)-2-(2-methoxy-benzylamino)-1-methyl-ethyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL23730 Gonadotropin-releasing hormone receptor Homo sapiens 20 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132755 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132755&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 10347081 104023731 CHEMBL23730 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242309 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNCc2ccccc2C)c1=O InChI=1S/C30H31F2N3O3/c1-19-9-5-6-10-23(19)17-33-16-20(2)35-29(36)28(22-11-7-12-24(15-22)38-4)21(3)34(30(35)37)18-25-26(31)13-8-14-27(25)32/h5-15,20,33H,16-18H2,1-4H3 KAXKWVLLPWTTSQ-UHFFFAOYSA-N 50132746 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[(R)-1-methyl-2-(2-methyl-benzylamino)-ethyl]-1H-pyrimidine-2,4-dione::CHEMBL23321 Gonadotropin-releasing hormone receptor Homo sapiens 70 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132746 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132746&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11179922 104023722 CHEMBL23321 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242310 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@@H](C)CNCc2ccccc2OC)c1=O InChI=1S/C30H31F2N3O4/c1-19(16-33-17-22-9-5-6-14-27(22)39-4)35-29(36)28(21-10-7-11-23(15-21)38-3)20(2)34(30(35)37)18-24-25(31)12-8-13-26(24)32/h5-15,19,33H,16-18H2,1-4H3 QUAHGERGEDVAKS-UHFFFAOYSA-N 50132747 1-(2,6-Difluoro-benzyl)-3-[(S)-2-(2-methoxy-benzylamino)-1-methyl-ethyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL23256 Gonadotropin-releasing hormone receptor Homo sapiens 320 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132747 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132747&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11785958 104023723 CHEMBL23256 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242311 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@@H](C)CNCC(C)C)c1=O InChI=1S/C26H31F2N3O3/c1-16(2)13-29-14-17(3)31-25(32)24(19-8-6-9-20(12-19)34-5)18(4)30(26(31)33)15-21-22(27)10-7-11-23(21)28/h6-12,16-17,29H,13-15H2,1-5H3 CGNXZWZVWKPVAS-UHFFFAOYSA-N 50132748 1-(2,6-Difluoro-benzyl)-3-((S)-2-isobutylamino-1-methyl-ethyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL112131 Gonadotropin-releasing hormone receptor Homo sapiens 1200 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132748 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132748&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340631 104023724 CHEMBL112131 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242312 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNCc2cccc(F)c2)c1=O InChI=1S/C29H28F3N3O3/c1-18(15-33-16-20-7-4-9-22(30)13-20)35-28(36)27(21-8-5-10-23(14-21)38-3)19(2)34(29(35)37)17-24-25(31)11-6-12-26(24)32/h4-14,18,33H,15-17H2,1-3H3 BNVVTOQKKGNWTP-UHFFFAOYSA-N 50132749 1-(2,6-Difluoro-benzyl)-3-[(R)-2-(3-fluoro-benzylamino)-1-methyl-ethyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL111933 Gonadotropin-releasing hormone receptor Homo sapiens 85 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132749 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132749&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340824 104023725 CHEMBL111933 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242313 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@@H](C)CNC2CCCC2)c1=O InChI=1S/C27H31F2N3O3/c1-17(15-30-20-9-4-5-10-20)32-26(33)25(19-8-6-11-21(14-19)35-3)18(2)31(27(32)34)16-22-23(28)12-7-13-24(22)29/h6-8,11-14,17,20,30H,4-5,9-10,15-16H2,1-3H3 FZFSCDONZGYLTG-UHFFFAOYSA-N 50132750 3-((S)-2-Cyclopentylamino-1-methyl-ethyl)-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL112881 Gonadotropin-releasing hormone receptor Homo sapiens 950 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132750 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132750&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340642 104023726 CHEMBL112881 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242314 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNCc2ccc(F)cc2)c1=O InChI=1S/C29H28F3N3O3/c1-18(15-33-16-20-10-12-22(30)13-11-20)35-28(36)27(21-6-4-7-23(14-21)38-3)19(2)34(29(35)37)17-24-25(31)8-5-9-26(24)32/h4-14,18,33H,15-17H2,1-3H3 TXQOGQDMBNSQEW-UHFFFAOYSA-N 50132751 1-(2,6-Difluoro-benzyl)-3-[(R)-2-(4-fluoro-benzylamino)-1-methyl-ethyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL110052 Gonadotropin-releasing hormone receptor Homo sapiens 250 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132751 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132751&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340804 104023727 CHEMBL110052 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242315 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CN(C)Cc2ccccc2)c1=O InChI=1S/C30H31F2N3O3/c1-20(17-33(3)18-22-10-6-5-7-11-22)35-29(36)28(23-12-8-13-24(16-23)38-4)21(2)34(30(35)37)19-25-26(31)14-9-15-27(25)32/h5-16,20H,17-19H2,1-4H3 XDMMCTICBNVRHD-UHFFFAOYSA-N 50132752 3-[(R)-2-(Benzyl-methyl-amino)-1-methyl-ethyl]-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL113183 Gonadotropin-releasing hormone receptor Homo sapiens 150 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132752 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132752&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340720 104023728 CHEMBL113183 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242316 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CN(C)CC2CC2)c1=O InChI=1S/C27H31F2N3O3/c1-17(14-30(3)15-19-11-12-19)32-26(33)25(20-7-5-8-21(13-20)35-4)18(2)31(27(32)34)16-22-23(28)9-6-10-24(22)29/h5-10,13,17,19H,11-12,14-16H2,1-4H3 OKPAYFFQWSXKKJ-UHFFFAOYSA-N 50132754 3-[(R)-2-(Cyclopropylmethyl-methyl-amino)-1-methyl-ethyl]-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL325233 Gonadotropin-releasing hormone receptor Homo sapiens 590 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132754 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132754&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340844 104023730 CHEMBL325233 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242317 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNCC2CC2)c1=O InChI=1S/C26H29F2N3O3/c1-16(13-29-14-18-10-11-18)31-25(32)24(19-6-4-7-20(12-19)34-3)17(2)30(26(31)33)15-21-22(27)8-5-9-23(21)28/h4-9,12,16,18,29H,10-11,13-15H2,1-3H3 UUOQULXFEYRBEL-UHFFFAOYSA-N 50132753 3-[(R)-2-(Cyclopropylmethyl-amino)-1-methyl-ethyl]-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL114619 Gonadotropin-releasing hormone receptor Homo sapiens 780 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132753 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132753&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44341074 104023729 CHEMBL114619 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242318 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNCc2ccccc2OC)c1=O InChI=1S/C30H31F2N3O4/c1-19(16-33-17-22-9-5-6-14-27(22)39-4)35-29(36)28(21-10-7-11-23(15-21)38-3)20(2)34(30(35)37)18-24-25(31)12-8-13-26(24)32/h5-15,19,33H,16-18H2,1-4H3 QUAHGERGEDVAKS-UHFFFAOYSA-N 50132755 1-(2,6-Difluoro-benzyl)-3-[(R)-2-(2-methoxy-benzylamino)-1-methyl-ethyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL23730 Gonadotropin-releasing hormone receptor Homo sapiens 160 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132755 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132755&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 10347081 104023731 CHEMBL23730 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242319 COc1ccc(CNC[C@@H](C)n2c(=O)c(c(C)n(Cc3c(F)cccc3F)c2=O)-c2cccc(OC)c2)cc1 InChI=1S/C30H31F2N3O4/c1-19(16-33-17-21-11-13-23(38-3)14-12-21)35-29(36)28(22-7-5-8-24(15-22)39-4)20(2)34(30(35)37)18-25-26(31)9-6-10-27(25)32/h5-15,19,33H,16-18H2,1-4H3 IFXPGGOXLMDWHJ-UHFFFAOYSA-N 50132756 1-(2,6-Difluoro-benzyl)-3-[(R)-2-(4-methoxy-benzylamino)-1-methyl-ethyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL331592 Gonadotropin-releasing hormone receptor Homo sapiens 720 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132756 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132756&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340840 104023732 CHEMBL331592 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242320 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@@H](C)CN(C)CC2CC2)c1=O InChI=1S/C27H31F2N3O3/c1-17(14-30(3)15-19-11-12-19)32-26(33)25(20-7-5-8-21(13-20)35-4)18(2)31(27(32)34)16-22-23(28)9-6-10-24(22)29/h5-10,13,17,19H,11-12,14-16H2,1-4H3 OKPAYFFQWSXKKJ-UHFFFAOYSA-N 50132757 3-[(S)-2-(Cyclopropylmethyl-methyl-amino)-1-methyl-ethyl]-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL112625 Gonadotropin-releasing hormone receptor Homo sapiens 7000 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132757 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132757&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340860 104023733 CHEMBL112625 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242321 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@@H](C)CNCC2CC2)c1=O InChI=1S/C26H29F2N3O3/c1-16(13-29-14-18-10-11-18)31-25(32)24(19-6-4-7-20(12-19)34-3)17(2)30(26(31)33)15-21-22(27)8-5-9-23(21)28/h4-9,12,16,18,29H,10-11,13-15H2,1-3H3 UUOQULXFEYRBEL-UHFFFAOYSA-N 50132758 3-[(S)-2-(Cyclopropylmethyl-amino)-1-methyl-ethyl]-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL114183 Gonadotropin-releasing hormone receptor Homo sapiens 1600 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132758 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132758&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340845 104023734 CHEMBL114183 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242322 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNC2CCCC2)c1=O InChI=1S/C27H31F2N3O3/c1-17(15-30-20-9-4-5-10-20)32-26(33)25(19-8-6-11-21(14-19)35-3)18(2)31(27(32)34)16-22-23(28)12-7-13-24(22)29/h6-8,11-14,17,20,30H,4-5,9-10,15-16H2,1-3H3 FZFSCDONZGYLTG-UHFFFAOYSA-N 50132762 3-((R)-2-Cyclopentylamino-1-methyl-ethyl)-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL112188 Gonadotropin-releasing hormone receptor Homo sapiens 430 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132762 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132762&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340632 104023738 CHEMBL112188 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242323 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNCc2ccccc2)c1=O InChI=1S/C29H29F2N3O3/c1-19(16-32-17-21-9-5-4-6-10-21)34-28(35)27(22-11-7-12-23(15-22)37-3)20(2)33(29(34)36)18-24-25(30)13-8-14-26(24)31/h4-15,19,32H,16-18H2,1-3H3 VXBUHYDJOPKQGI-UHFFFAOYSA-N 50132761 3-((R)-2-Benzylamino-1-methyl-ethyl)-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL23237 Gonadotropin-releasing hormone receptor Homo sapiens 75 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132761 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132761&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11214295 104023737 CHEMBL23237 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242324 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C2CCN(Cc3ccccc3)C2)c1=O InChI=1S/C30H29F2N3O3/c1-20-28(22-10-6-11-24(16-22)38-2)29(36)35(23-14-15-33(18-23)17-21-8-4-3-5-9-21)30(37)34(20)19-25-26(31)12-7-13-27(25)32/h3-13,16,23H,14-15,17-19H2,1-2H3 HXIPSJVVGOYXPH-UHFFFAOYSA-N 50132760 3-(1-Benzyl-pyrrolidin-3-yl)-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL114399 Gonadotropin-releasing hormone receptor Homo sapiens 280 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132760 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132760&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340644 104023736 CHEMBL114399 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242325 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNCC(C)C)c1=O InChI=1S/C26H31F2N3O3/c1-16(2)13-29-14-17(3)31-25(32)24(19-8-6-9-20(12-19)34-5)18(4)30(26(31)33)15-21-22(27)10-7-11-23(21)28/h6-12,16-17,29H,13-15H2,1-5H3 CGNXZWZVWKPVAS-UHFFFAOYSA-N 50132759 1-(2,6-Difluoro-benzyl)-3-((R)-2-isobutylamino-1-methyl-ethyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL113068 Gonadotropin-releasing hormone receptor Homo sapiens 190 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132759 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132759&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340635 104023735 CHEMBL113068 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242326 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@@H](C)CNCc2ccccc2)c1=O InChI=1S/C29H29F2N3O3/c1-19(16-32-17-21-9-5-4-6-10-21)34-28(35)27(22-11-7-12-23(15-22)37-3)20(2)33(29(34)36)18-24-25(30)13-8-14-26(24)31/h4-15,19,32H,16-18H2,1-3H3 VXBUHYDJOPKQGI-UHFFFAOYSA-N 50132763 3-((S)-2-Benzylamino-1-methyl-ethyl)-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL432262 Gonadotropin-releasing hormone receptor Homo sapiens 370 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132763 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132763&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11260648 104023739 CHEMBL432262 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242327 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@H](C)N(C)CCc2ccccn2)c1=O |r| InChI=1S/C30H32F2N4O3/c1-20(34(3)16-14-23-10-5-6-15-33-23)18-36-29(37)28(22-9-7-11-24(17-22)39-4)21(2)35(30(36)38)19-25-26(31)12-8-13-27(25)32/h5-13,15,17,20H,14,16,18-19H2,1-4H3 OFKJZTZWKLEUHT-UHFFFAOYSA-N 50132732 (S)-1-(2,6-difluorobenzyl)-5-(3-methoxyphenyl)-6-methyl-3-(2-(methyl(2-(pyridin-2-yl)ethyl)amino)propyl)pyrimidine-2,4(1H,3H)-dione::1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{(S)-2-[methyl-(2-pyridin-2-yl-ethyl)-amino]-propyl}-1H-pyrimidine-2,4-dione::CHEMBL111820 Gonadotropin-releasing hormone receptor Homo sapiens 5 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132732 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132732&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340652 104023708 CHEMBL111820 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242329 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@@H](C)CNCc2ccccc2F)c1=O InChI=1S/C29H28F3N3O3/c1-18(15-33-16-21-8-4-5-11-24(21)30)35-28(36)27(20-9-6-10-22(14-20)38-3)19(2)34(29(35)37)17-23-25(31)12-7-13-26(23)32/h4-14,18,33H,15-17H2,1-3H3 VUIUYLRWRNMOSS-UHFFFAOYSA-N 50132765 1-(2,6-Difluoro-benzyl)-3-[(S)-2-(2-fluoro-benzylamino)-1-methyl-ethyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL112461 Gonadotropin-releasing hormone receptor Homo sapiens 550 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132765 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132765&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340612 104023741 CHEMBL112461 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242330 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNCc2ccccc2OC)c1=O InChI=1S/C30H31F2N3O4/c1-19(16-33-17-22-9-5-6-14-27(22)39-4)35-29(36)28(21-10-7-11-23(15-21)38-3)20(2)34(30(35)37)18-24-25(31)12-8-13-26(24)32/h5-15,19,33H,16-18H2,1-4H3 QUAHGERGEDVAKS-UHFFFAOYSA-N 50132755 1-(2,6-Difluoro-benzyl)-3-[(R)-2-(2-methoxy-benzylamino)-1-methyl-ethyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL23730 Gonadotropin-releasing hormone receptor Rattus norvegicus 12700 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132755 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132755&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 10347081 104023731 CHEMBL23730 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50242331 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CNCc2ccccc2F)c1=O InChI=1S/C29H28F3N3O3/c1-18(15-33-16-21-8-4-5-11-24(21)30)35-28(36)27(20-9-6-10-22(14-20)38-3)19(2)34(29(35)37)17-23-25(31)12-7-13-26(23)32/h4-14,18,33H,15-17H2,1-3H3 VUIUYLRWRNMOSS-UHFFFAOYSA-N 50132764 1-(2,6-Difluoro-benzyl)-3-[(R)-2-(2-fluoro-benzylamino)-1-methyl-ethyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL111980 Gonadotropin-releasing hormone receptor Homo sapiens 90 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132764 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132764&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340623 104023740 CHEMBL111980 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242332 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CCN(C)CCc2ccccn2)c1=O InChI=1S/C29H30F2N4O3/c1-20-27(21-8-6-10-23(18-21)38-3)28(36)34(17-16-33(2)15-13-22-9-4-5-14-32-22)29(37)35(20)19-24-25(30)11-7-12-26(24)31/h4-12,14,18H,13,15-17,19H2,1-3H3 JWKDAXNMZQKVPL-UHFFFAOYSA-N 50132728 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{2-[methyl-(2-pyridin-2-yl-ethyl)-amino]-ethyl}-1H-pyrimidine-2,4-dione::CHEMBL23830 Gonadotropin-releasing hormone receptor Homo sapiens 34 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132728 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132728&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 9958318 104023704 CHEMBL23830 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242333 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@@H](C)CN(C)Cc2ccccc2)c1=O InChI=1S/C30H31F2N3O3/c1-20(17-33(3)18-22-10-6-5-7-11-22)35-29(36)28(23-12-8-13-24(16-23)38-4)21(2)34(30(35)37)19-25-26(31)14-9-15-27(25)32/h5-16,20H,17-19H2,1-4H3 XDMMCTICBNVRHD-UHFFFAOYSA-N 50132766 3-[(S)-2-(Benzyl-methyl-amino)-1-methyl-ethyl]-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL112730 Gonadotropin-releasing hormone receptor Homo sapiens 2000 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132766 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132766&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340670 104023742 CHEMBL112730 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242334 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C2CCNC2)c1=O InChI=1S/C23H23F2N3O3/c1-14-21(15-5-3-6-17(11-15)31-2)22(29)28(16-9-10-26-12-16)23(30)27(14)13-18-19(24)7-4-8-20(18)25/h3-8,11,16,26H,9-10,12-13H2,1-2H3 JSEWNRZOBBMHTH-UHFFFAOYSA-N 50132770 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-pyrrolidin-3-yl-1H-pyrimidine-2,4-dione::CHEMBL114370 Gonadotropin-releasing hormone receptor Homo sapiens 15000 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132770 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132770&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44341075 104023746 CHEMBL114370 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242335 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@@H](C)CNCc2ccccc2C)c1=O InChI=1S/C30H31F2N3O3/c1-19-9-5-6-10-23(19)17-33-16-20(2)35-29(36)28(22-11-7-12-24(15-22)38-4)21(3)34(30(35)37)18-25-26(31)13-8-14-27(25)32/h5-15,20,33H,16-18H2,1-4H3 KAXKWVLLPWTTSQ-UHFFFAOYSA-N 50132767 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[(S)-1-methyl-2-(2-methyl-benzylamino)-ethyl]-1H-pyrimidine-2,4-dione::CHEMBL282707 Gonadotropin-releasing hormone receptor Homo sapiens 400 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132767 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132767&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11168330 104023743 CHEMBL282707 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242336 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@H](C)CN(C)CCc2ccccn2)c1=O InChI=1S/C30H32F2N4O3/c1-20(18-34(3)16-14-23-10-5-6-15-33-23)36-29(37)28(22-9-7-11-24(17-22)39-4)21(2)35(30(36)38)19-25-26(31)12-8-13-27(25)32/h5-13,15,17,20H,14,16,18-19H2,1-4H3 GNENPVYUZQIQKL-UHFFFAOYSA-N 50132768 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{(R)-1-methyl-2-[methyl-(2-pyridin-2-yl-ethyl)-amino]-ethyl}-1H-pyrimidine-2,4-dione::CHEMBL326804 Gonadotropin-releasing hormone receptor Homo sapiens 20 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132768 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132768&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 10098618 104023744 CHEMBL326804 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242337 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C2CCN(CCc3ccccn3)C2)c1=O InChI=1S/C30H30F2N4O3/c1-20-28(21-7-5-9-24(17-21)39-2)29(37)36(30(38)35(20)19-25-26(31)10-6-11-27(25)32)23-13-16-34(18-23)15-12-22-8-3-4-14-33-22/h3-11,14,17,23H,12-13,15-16,18-19H2,1-2H3 BWXKRPNZKGJTSE-UHFFFAOYSA-N 50132769 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[1-(2-pyridin-2-yl-ethyl)-pyrrolidin-3-yl]-1H-pyrimidine-2,4-dione::CHEMBL326885 Gonadotropin-releasing hormone receptor Homo sapiens 8300 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132769 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132769&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340643 104023745 CHEMBL326885 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242338 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n([C@@H](C)CN(C)CCc2ccccn2)c1=O InChI=1S/C30H32F2N4O3/c1-20(18-34(3)16-14-23-10-5-6-15-33-23)36-29(37)28(22-9-7-11-24(17-22)39-4)21(2)35(30(36)38)19-25-26(31)12-8-13-27(25)32/h5-13,15,17,20H,14,16,18-19H2,1-4H3 GNENPVYUZQIQKL-UHFFFAOYSA-N 50132772 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{(S)-1-methyl-2-[methyl-(2-pyridin-2-yl-ethyl)-amino]-ethyl}-1H-pyrimidine-2,4-dione::CHEMBL419212 Gonadotropin-releasing hormone receptor Homo sapiens 1800 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132772 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132772&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44341057 104023748 CHEMBL419212 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242339 COc1cccc(CNC[C@@H](C)n2c(=O)c(c(C)n(Cc3c(F)cccc3F)c2=O)-c2cccc(OC)c2)c1 InChI=1S/C30H31F2N3O4/c1-19(16-33-17-21-8-5-10-23(14-21)38-3)35-29(36)28(22-9-6-11-24(15-22)39-4)20(2)34(30(35)37)18-25-26(31)12-7-13-27(25)32/h5-15,19,33H,16-18H2,1-4H3 IFTSZJBFFKLIJT-UHFFFAOYSA-N 50132771 1-(2,6-Difluoro-benzyl)-3-[(R)-2-(3-methoxy-benzylamino)-1-methyl-ethyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL112559 Gonadotropin-releasing hormone receptor Homo sapiens 20 ChEMBL 10.1016/s0960-894x(03)00619-x 10.7270/Q2P26XJ4 12951117 Tucci, FC; Zhu, YF; Guo, Z; Gross, TD; Connors, PJ; Struthers, RS; Reinhart, GJ; Saunders, J; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132771 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132771&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 10007333 104023747 CHEMBL112559 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644