BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50021841 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@@H](C)N(C)Cc2ccccn2)c1=O |r| InChI=1S/C29H30F2N4O3/c1-19(33(3)17-22-10-5-6-14-32-22)16-35-28(36)27(21-9-7-11-23(15-21)38-4)20(2)34(29(35)37)18-24-25(30)12-8-13-26(24)31/h5-15,19H,16-18H2,1-4H3 ACHAWAOSLYJAMP-UHFFFAOYSA-N 50132726 (R)-1-(2,6-difluorobenzyl)-5-(3-methoxyphenyl)-6-methyl-3-(2-(methyl(pyridin-2-ylmethyl)amino)propyl)pyrimidine-2,4(1H,3H)-dione::1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[(R)-2-(methyl-pyridin-2-ylmethyl-amino)-propyl]-1H-pyrimidine-2,4-dione::CHEMBL112466 Gonadotropin-releasing hormone receptor Homo sapiens 102 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132726 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132726&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340637 104023702 CHEMBL112466 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242279 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@@H](C)NCc2ccccc2)c1=O InChI=1S/C29H29F2N3O3/c1-19(32-16-21-9-5-4-6-10-21)17-34-28(35)27(22-11-7-12-23(15-22)37-3)20(2)33(29(34)36)18-24-25(30)13-8-14-26(24)31/h4-15,19,32H,16-18H2,1-3H3 IMSNMXOGTCRJBF-UHFFFAOYSA-N 50132721 3-((R)-2-Benzylamino-propyl)-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL23767 Gonadotropin-releasing hormone receptor Homo sapiens 130 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132721 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132721&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11179660 104023697 CHEMBL23767 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242280 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@@H]2CCCN2Cc2ccccn2)c1=O InChI=1S/C30H30F2N4O3/c1-20-28(21-8-5-11-24(16-21)39-2)29(37)36(30(38)35(20)19-25-26(31)12-6-13-27(25)32)18-23-10-7-15-34(23)17-22-9-3-4-14-33-22/h3-6,8-9,11-14,16,23H,7,10,15,17-19H2,1-2H3 BIBBCWVYCRICCF-UHFFFAOYSA-N 50132720 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-((S)-1-pyridin-2-ylmethyl-pyrrolidin-2-ylmethyl)-1H-pyrimidine-2,4-dione::CHEMBL431248 Gonadotropin-releasing hormone receptor Homo sapiens 210 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132720 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132720&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340783 104023696 CHEMBL431248 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242281 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@H](C)N(C)Cc2ccccc2)c1=O InChI=1S/C30H31F2N3O3/c1-20(33(3)18-22-10-6-5-7-11-22)17-35-29(36)28(23-12-8-13-24(16-23)38-4)21(2)34(30(35)37)19-25-26(31)14-9-15-27(25)32/h5-16,20H,17-19H2,1-4H3 IPCZJLSGFREFJV-UHFFFAOYSA-N 50132722 3-[(S)-2-(Benzyl-methyl-amino)-propyl]-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL112093 Gonadotropin-releasing hormone receptor Homo sapiens 250 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132722 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132722&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340784 104023698 CHEMBL112093 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242282 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CC(C)N(C)CCc2ccccn2)c1=O InChI=1S/C30H32F2N4O3/c1-20(34(3)16-14-23-10-5-6-15-33-23)18-36-29(37)28(22-9-7-11-24(17-22)39-4)21(2)35(30(36)38)19-25-26(31)12-8-13-27(25)32/h5-13,15,17,20H,14,16,18-19H2,1-4H3 OFKJZTZWKLEUHT-UHFFFAOYSA-N 50132719 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{2-[methyl-(2-pyridin-2-yl-ethyl)-amino]-propyl}-1H-pyrimidine-2,4-dione::CHEMBL112287 Gonadotropin-releasing hormone receptor Homo sapiens 12 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132719 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132719&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340788 104023695 CHEMBL112287 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242283 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@H](C)NCc2ccccc2)c1=O InChI=1S/C29H29F2N3O3/c1-19(32-16-21-9-5-4-6-10-21)17-34-28(35)27(22-11-7-12-23(15-22)37-3)20(2)33(29(34)36)18-24-25(30)13-8-14-26(24)31/h4-15,19,32H,16-18H2,1-3H3 IMSNMXOGTCRJBF-UHFFFAOYSA-N 50132723 3-((S)-2-Benzylamino-propyl)-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL25714 Gonadotropin-releasing hormone receptor Homo sapiens 140 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132723 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132723&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11283517 104023699 CHEMBL25714 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242284 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@@H](C)N(C)CCc2ccccn2)c1=O |r| InChI=1S/C30H32F2N4O3/c1-20(34(3)16-14-23-10-5-6-15-33-23)18-36-29(37)28(22-9-7-11-24(17-22)39-4)21(2)35(30(36)38)19-25-26(31)12-8-13-27(25)32/h5-13,15,17,20H,14,16,18-19H2,1-4H3 OFKJZTZWKLEUHT-UHFFFAOYSA-N 50132724 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{(R)-2-[methyl-(2-pyridin-2-yl-ethyl)-amino]-propyl}-1H-pyrimidine-2,4-dione::(R)-1-(2,6-difluorobenzyl)-5-(3-methoxyphenyl)-6-methyl-3-(2-(methyl(2-(pyridin-2-yl)ethyl)amino)propyl)pyrimidine-2,4(1H,3H)-dione::CHEMBL321376 Gonadotropin-releasing hormone receptor Homo sapiens 5.2 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132724 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132724&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340749 104023700 CHEMBL321376 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242285 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CC(C)NCCCOCC(C)C)c1=O InChI=1S/C29H37F2N3O4/c1-19(2)18-38-14-8-13-32-20(3)16-34-28(35)27(22-9-6-10-23(15-22)37-5)21(4)33(29(34)36)17-24-25(30)11-7-12-26(24)31/h6-7,9-12,15,19-20,32H,8,13-14,16-18H2,1-5H3 HZTMVHRHUISCDR-UHFFFAOYSA-N 50132725 1-(2,6-Difluoro-benzyl)-3-[2-(3-isobutoxy-propylamino)-propyl]-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL325391 Gonadotropin-releasing hormone receptor Homo sapiens 81 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132725 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132725&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340641 104023701 CHEMBL325391 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242286 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CCNCCc2ccccn2)c1=O InChI=1S/C28H28F2N4O3/c1-19-26(20-7-5-9-22(17-20)37-2)27(35)33(16-15-31-14-12-21-8-3-4-13-32-21)28(36)34(19)18-23-24(29)10-6-11-25(23)30/h3-11,13,17,31H,12,14-16,18H2,1-2H3 MJIPJUSLMJMQDZ-UHFFFAOYSA-N 50128013 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[2-(2-pyridin-2-yl-ethylamino)-ethyl]-1H-pyrimidine-2,4-dione::CHEMBL64148 Gonadotropin-releasing hormone receptor Homo sapiens 1100 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50128013 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50128013&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 9892420 104019817 CHEMBL64148 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242287 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CCN(C)CCc2ccccn2)c1=O InChI=1S/C29H30F2N4O3/c1-20-27(21-8-6-10-23(18-21)38-3)28(36)34(17-16-33(2)15-13-22-9-4-5-14-32-22)29(37)35(20)19-24-25(30)11-7-12-26(24)31/h4-12,14,18H,13,15-17,19H2,1-3H3 JWKDAXNMZQKVPL-UHFFFAOYSA-N 50132728 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{2-[methyl-(2-pyridin-2-yl-ethyl)-amino]-ethyl}-1H-pyrimidine-2,4-dione::CHEMBL23830 Gonadotropin-releasing hormone receptor Homo sapiens 34 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132728 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132728&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 9958318 104023704 CHEMBL23830 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242288 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@@H](C)NCc2ccccn2)c1=O |r| InChI=1S/C28H28F2N4O3/c1-18(32-15-21-9-4-5-13-31-21)16-34-27(35)26(20-8-6-10-22(14-20)37-3)19(2)33(28(34)36)17-23-24(29)11-7-12-25(23)30/h4-14,18,32H,15-17H2,1-3H3 OPBYZYBHFFPQKX-UHFFFAOYSA-N 50132729 (R)-1-(2,6-difluorobenzyl)-5-(3-methoxyphenyl)-6-methyl-3-(2-(pyridin-2-ylmethylamino)propyl)pyrimidine-2,4(1H,3H)-dione::1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{(R)-2-[(pyridin-2-ylmethyl)-amino]-propyl}-1H-pyrimidine-2,4-dione::CHEMBL23854 Gonadotropin-releasing hormone receptor Homo sapiens 15 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132729 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132729&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11249167 104023705 CHEMBL23854 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242289 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@@H](C)N(C)Cc2ccccc2)c1=O InChI=1S/C30H31F2N3O3/c1-20(33(3)18-22-10-6-5-7-11-22)17-35-29(36)28(23-12-8-13-24(16-23)38-4)21(2)34(30(35)37)19-25-26(31)14-9-15-27(25)32/h5-16,20H,17-19H2,1-4H3 IPCZJLSGFREFJV-UHFFFAOYSA-N 50132727 3-[(R)-2-(Benzyl-methyl-amino)-propyl]-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL113216 Gonadotropin-releasing hormone receptor Homo sapiens 330 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132727 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132727&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340771 104023703 CHEMBL113216 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242290 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CCN(C)Cc2ccccn2)c1=O InChI=1S/C28H28F2N4O3/c1-19-26(20-8-6-10-22(16-20)37-3)27(35)33(15-14-32(2)17-21-9-4-5-13-31-21)28(36)34(19)18-23-24(29)11-7-12-25(23)30/h4-13,16H,14-15,17-18H2,1-3H3 UFXOSDJXIGXBES-UHFFFAOYSA-N 50132730 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[2-(methyl-pyridin-2-ylmethyl-amino)-ethyl]-1H-pyrimidine-2,4-dione::CHEMBL112611 Gonadotropin-releasing hormone receptor Homo sapiens 96 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132730 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132730&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340688 104023706 CHEMBL112611 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242291 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@H]2CCCN2Cc2ccccn2)c1=O InChI=1S/C30H30F2N4O3/c1-20-28(21-8-5-11-24(16-21)39-2)29(37)36(30(38)35(20)19-25-26(31)12-6-13-27(25)32)18-23-10-7-15-34(23)17-22-9-3-4-14-33-22/h3-6,8-9,11-14,16,23H,7,10,15,17-19H2,1-2H3 BIBBCWVYCRICCF-UHFFFAOYSA-N 50132731 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-((R)-1-pyridin-2-ylmethyl-pyrrolidin-2-ylmethyl)-1H-pyrimidine-2,4-dione::CHEMBL325326 Gonadotropin-releasing hormone receptor Homo sapiens 32 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132731 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132731&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340808 104023707 CHEMBL325326 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242292 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@H](C)NCCc2ccccn2)c1=O InChI=1S/C29H30F2N4O3/c1-19(32-15-13-22-9-4-5-14-33-22)17-35-28(36)27(21-8-6-10-23(16-21)38-3)20(2)34(29(35)37)18-24-25(30)11-7-12-26(24)31/h4-12,14,16,19,32H,13,15,17-18H2,1-3H3 GBIGANWALGHZOR-UHFFFAOYSA-N 50132734 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[(S)-2-(2-pyridin-2-yl-ethylamino)-propyl]-1H-pyrimidine-2,4-dione::CHEMBL280430 Gonadotropin-releasing hormone receptor Homo sapiens 780 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132734 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132734&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11455176 104023710 CHEMBL280430 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242293 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CC(C)NCCc2ccccn2)c1=O InChI=1S/C29H30F2N4O3/c1-19(32-15-13-22-9-4-5-14-33-22)17-35-28(36)27(21-8-6-10-23(16-21)38-3)20(2)34(29(35)37)18-24-25(30)11-7-12-26(24)31/h4-12,14,16,19,32H,13,15,17-18H2,1-3H3 GBIGANWALGHZOR-UHFFFAOYSA-N 50132735 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[2-(2-pyridin-2-yl-ethylamino)-propyl]-1H-pyrimidine-2,4-dione::CHEMBL334037 Gonadotropin-releasing hormone receptor Homo sapiens 170 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132735 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132735&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340785 104023711 CHEMBL334037 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242294 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@H](C)N(C)CCc2ccccn2)c1=O |r| InChI=1S/C30H32F2N4O3/c1-20(34(3)16-14-23-10-5-6-15-33-23)18-36-29(37)28(22-9-7-11-24(17-22)39-4)21(2)35(30(36)38)19-25-26(31)12-8-13-27(25)32/h5-13,15,17,20H,14,16,18-19H2,1-4H3 OFKJZTZWKLEUHT-UHFFFAOYSA-N 50132732 (S)-1-(2,6-difluorobenzyl)-5-(3-methoxyphenyl)-6-methyl-3-(2-(methyl(2-(pyridin-2-yl)ethyl)amino)propyl)pyrimidine-2,4(1H,3H)-dione::1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{(S)-2-[methyl-(2-pyridin-2-yl-ethyl)-amino]-propyl}-1H-pyrimidine-2,4-dione::CHEMBL111820 Gonadotropin-releasing hormone receptor Homo sapiens 890 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132732 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132732&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340652 104023708 CHEMBL111820 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242295 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@H](C)N(C)Cc2ccccn2)c1=O InChI=1S/C29H30F2N4O3/c1-19(33(3)17-22-10-5-6-14-32-22)16-35-28(36)27(21-9-7-11-23(15-21)38-4)20(2)34(29(35)37)18-24-25(30)12-8-13-26(24)31/h5-15,19H,16-18H2,1-4H3 ACHAWAOSLYJAMP-UHFFFAOYSA-N 50132736 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[(S)-2-(methyl-pyridin-2-ylmethyl-amino)-propyl]-1H-pyrimidine-2,4-dione::CHEMBL324759 Gonadotropin-releasing hormone receptor Homo sapiens 470 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132736 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132736&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340656 104023712 CHEMBL324759 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242296 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CC(C)N(C)Cc2ccccn2)c1=O InChI=1S/C29H30F2N4O3/c1-19(33(3)17-22-10-5-6-14-32-22)16-35-28(36)27(21-9-7-11-23(15-21)38-4)20(2)34(29(35)37)18-24-25(30)12-8-13-26(24)31/h5-15,19H,16-18H2,1-4H3 ACHAWAOSLYJAMP-UHFFFAOYSA-N 50132733 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[2-(methyl-pyridin-2-ylmethyl-amino)-propyl]-1H-pyrimidine-2,4-dione::CHEMBL113151 Gonadotropin-releasing hormone receptor Homo sapiens 18 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132733 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132733&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11318370 104023709 CHEMBL113151 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242297 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@@H](C)N)c1=O InChI=1S/C22H23F2N3O3/c1-13(25)11-27-21(28)20(15-6-4-7-16(10-15)30-3)14(2)26(22(27)29)12-17-18(23)8-5-9-19(17)24/h4-10,13H,11-12,25H2,1-3H3 AYPFBVKPMHZLON-UHFFFAOYSA-N 50132737 3-((R)-2-Amino-propyl)-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL326510 Gonadotropin-releasing hormone receptor Homo sapiens 2500 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132737 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132737&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340636 104023713 CHEMBL326510 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242298 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CC(C)N(C)CCCOCC(C)C)c1=O InChI=1S/C30H39F2N3O4/c1-20(2)19-39-15-9-14-33(5)21(3)17-35-29(36)28(23-10-7-11-24(16-23)38-6)22(4)34(30(35)37)18-25-26(31)12-8-13-27(25)32/h7-8,10-13,16,20-21H,9,14-15,17-19H2,1-6H3 IBGOMPAQWPCHCV-UHFFFAOYSA-N 50132738 1-(2,6-Difluoro-benzyl)-3-{2-[(3-isobutoxy-propyl)-methyl-amino]-propyl}-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL113455 Gonadotropin-releasing hormone receptor Homo sapiens 240 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132738 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132738&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340780 104023714 CHEMBL113455 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242299 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CC(C)N(C)Cc2ccccc2)c1=O InChI=1S/C30H31F2N3O3/c1-20(33(3)18-22-10-6-5-7-11-22)17-35-29(36)28(23-12-8-13-24(16-23)38-4)21(2)34(30(35)37)19-25-26(31)14-9-15-27(25)32/h5-16,20H,17-19H2,1-4H3 IPCZJLSGFREFJV-UHFFFAOYSA-N 50132740 3-[2-(Benzyl-methyl-amino)-propyl]-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL432585 Gonadotropin-releasing hormone receptor Homo sapiens 310 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132740 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132740&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340825 104023716 CHEMBL432585 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242300 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@H](C)NCc2ccccn2)c1=O InChI=1S/C28H28F2N4O3/c1-18(32-15-21-9-4-5-13-31-21)16-34-27(35)26(20-8-6-10-22(14-20)37-3)19(2)33(28(34)36)17-23-24(29)11-7-12-25(23)30/h4-14,18,32H,15-17H2,1-3H3 OPBYZYBHFFPQKX-UHFFFAOYSA-N 50132742 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{(S)-2-[(pyridin-2-ylmethyl)-amino]-propyl}-1H-pyrimidine-2,4-dione::CHEMBL23823 Gonadotropin-releasing hormone receptor Homo sapiens 460 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132742 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132742&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11386605 104023718 CHEMBL23823 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242302 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CCNCc2ccccn2)c1=O InChI=1S/C27H26F2N4O3/c1-18-25(19-7-5-9-21(15-19)36-2)26(34)32(14-13-30-16-20-8-3-4-12-31-20)27(35)33(18)17-22-23(28)10-6-11-24(22)29/h3-12,15,30H,13-14,16-17H2,1-2H3 VOLXEUOMDAYBKB-UHFFFAOYSA-N 50132743 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{2-[(pyridin-2-ylmethyl)-amino]-ethyl}-1H-pyrimidine-2,4-dione::CHEMBL325942 Gonadotropin-releasing hormone receptor Homo sapiens 550 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132743 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132743&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340697 104023719 CHEMBL325942 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242303 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CC(C)NCc2ccccc2)c1=O InChI=1S/C29H29F2N3O3/c1-19(32-16-21-9-5-4-6-10-21)17-34-28(35)27(22-11-7-12-23(15-22)37-3)20(2)33(29(34)36)18-24-25(30)13-8-14-26(24)31/h4-15,19,32H,16-18H2,1-3H3 IMSNMXOGTCRJBF-UHFFFAOYSA-N 50132739 3-(2-Benzylamino-propyl)-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL320920 Gonadotropin-releasing hormone receptor Homo sapiens 280 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132739 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132739&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340798 104023715 CHEMBL320920 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242304 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@H](C)N)c1=O InChI=1S/C22H23F2N3O3/c1-13(25)11-27-21(28)20(15-6-4-7-16(10-15)30-3)14(2)26(22(27)29)12-17-18(23)8-5-9-19(17)24/h4-10,13H,11-12,25H2,1-3H3 AYPFBVKPMHZLON-UHFFFAOYSA-N 50132741 3-((S)-2-Amino-propyl)-1-(2,6-difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-1H-pyrimidine-2,4-dione::CHEMBL322283 Gonadotropin-releasing hormone receptor Homo sapiens 18000 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132741 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132741&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340649 104023717 CHEMBL322283 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242305 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@@H](C)N(C)Cc2ccccn2)c1=O |r| InChI=1S/C29H30F2N4O3/c1-19(33(3)17-22-10-5-6-14-32-22)16-35-28(36)27(21-9-7-11-23(15-21)38-4)20(2)34(29(35)37)18-24-25(30)12-8-13-26(24)31/h5-15,19H,16-18H2,1-4H3 ACHAWAOSLYJAMP-UHFFFAOYSA-N 50132726 (R)-1-(2,6-difluorobenzyl)-5-(3-methoxyphenyl)-6-methyl-3-(2-(methyl(pyridin-2-ylmethyl)amino)propyl)pyrimidine-2,4(1H,3H)-dione::1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[(R)-2-(methyl-pyridin-2-ylmethyl-amino)-propyl]-1H-pyrimidine-2,4-dione::CHEMBL112466 Gonadotropin-releasing hormone receptor Homo sapiens 5.5 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132726 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132726&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340637 104023702 CHEMBL112466 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242306 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@@H](C)N(C)Cc2ccccn2)c1=O |r| InChI=1S/C29H30F2N4O3/c1-19(33(3)17-22-10-5-6-14-32-22)16-35-28(36)27(21-9-7-11-23(15-21)38-4)20(2)34(29(35)37)18-24-25(30)12-8-13-26(24)31/h5-15,19H,16-18H2,1-4H3 ACHAWAOSLYJAMP-UHFFFAOYSA-N 50132726 (R)-1-(2,6-difluorobenzyl)-5-(3-methoxyphenyl)-6-methyl-3-(2-(methyl(pyridin-2-ylmethyl)amino)propyl)pyrimidine-2,4(1H,3H)-dione::1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[(R)-2-(methyl-pyridin-2-ylmethyl-amino)-propyl]-1H-pyrimidine-2,4-dione::CHEMBL112466 Gonadotropin-releasing hormone receptor Rattus norvegicus 21000 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132726 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132726&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340637 104023702 CHEMBL112466 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50242307 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(CC(C)NCc2ccccn2)c1=O InChI=1S/C28H28F2N4O3/c1-18(32-15-21-9-4-5-13-31-21)16-34-27(35)26(20-8-6-10-22(14-20)37-3)19(2)33(28(34)36)17-23-24(29)11-7-12-25(23)30/h4-14,18,32H,15-17H2,1-3H3 OPBYZYBHFFPQKX-UHFFFAOYSA-N 50132744 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-{2-[(pyridin-2-ylmethyl)-amino]-propyl}-1H-pyrimidine-2,4-dione::CHEMBL113059 Gonadotropin-releasing hormone receptor Homo sapiens 53 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132744 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132744&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44340646 104023720 CHEMBL113059 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50242308 COc1cccc(c1)-c1c(C)n(Cc2c(F)cccc2F)c(=O)n(C[C@@H](C)NCCc2ccccn2)c1=O InChI=1S/C29H30F2N4O3/c1-19(32-15-13-22-9-4-5-14-33-22)17-35-28(36)27(21-8-6-10-23(16-21)38-3)20(2)34(29(35)37)18-24-25(30)11-7-12-26(24)31/h4-12,14,16,19,32H,13,15,17-18H2,1-3H3 GBIGANWALGHZOR-UHFFFAOYSA-N 50132745 1-(2,6-Difluoro-benzyl)-5-(3-methoxy-phenyl)-6-methyl-3-[(R)-2-(2-pyridin-2-yl-ethylamino)-propyl]-1H-pyrimidine-2,4-dione::CHEMBL23337 Gonadotropin-releasing hormone receptor Homo sapiens 79 ChEMBL 10.1016/s0960-894x(03)00620-6 10.7270/Q2ST7P73 12951116 Guo, Z; Zhu, YF; Tucci, FC; Gao, Y; Struthers, RS; Saunders, J; Gross, TD; Xie, Q; Reinhart, GJ; Chen, C 9/2/2003 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132745 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132745&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 11226171 104023721 CHEMBL23337 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644