BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50217978 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2-n2cc(C)nc12 |t:7| InChI=1S/C22H19ClFN3O2/c1-13-12-27-19-9-7-14(23)11-16(19)21(15-5-3-4-6-17(15)24)26-18(22(27)25-13)8-10-20(28)29-2/h3-7,9,11-12,18H,8,10H2,1-2H3 BRGDLUDFNXOQJE-UHFFFAOYSA-N 50120343 3-[(S)-8-Chloro-6-(2-fluoro-phenyl)-2-methyl-4H-3,5,10b-triaza-benzo[e]azulen-4-yl]-propionic acid methyl ester::CHEMBL320277 Translocator protein Rattus norvegicus 7 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120343 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120343&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 9887860 104013464 CHEMBL320277 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217979 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2-n2c(C)ncc12 |t:7| InChI=1S/C22H19ClFN3O2/c1-13-25-12-20-18(8-10-21(28)29-2)26-22(15-5-3-4-6-17(15)24)16-11-14(23)7-9-19(16)27(13)20/h3-7,9,11-12,18H,8,10H2,1-2H3 MCTILYQGJNAZGL-UHFFFAOYSA-N 50120344 3-[(S)-8-Chloro-6-(2-fluoro-phenyl)-1-methyl-4H-2,5,10b-triaza-benzo[e]azulen-4-yl]-propionic acid methyl ester::CHEMBL320728 Translocator protein Rattus norvegicus 11 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120344 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120344&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 9822927 104013465 CHEMBL320728 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217980 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2NC1=O |t:7| InChI=1S/C19H16ClFN2O3/c1-26-17(24)9-8-16-19(25)23-15-7-6-11(20)10-13(15)18(22-16)12-4-2-3-5-14(12)21/h2-7,10,16H,8-9H2,1H3,(H,23,25) DPCWHZBPEGAYOV-UHFFFAOYSA-N 50120340 3-[(S)-7-Chloro-5-(2-fluoro-phenyl)-2-oxo-2,3-dihydro-1H-benzo[e][1,4]diazepin-3-yl]-propionic acid methyl ester::CHEMBL108991 Translocator protein Rattus norvegicus 7 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120340 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120340&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 9799731 104013461 CHEMBL108991 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217981 CNC1=Nc2ccc(Cl)cc2C(=N[C@H]1CCC(=O)OC)c1ccccc1F |c:12,t:2| InChI=1S/C20H19ClFN3O2/c1-23-20-17(9-10-18(26)27-2)24-19(13-5-3-4-6-15(13)22)14-11-12(21)7-8-16(14)25-20/h3-8,11,17H,9-10H2,1-2H3,(H,23,25) GBLHSUPBJDLBCT-UHFFFAOYSA-N 50120345 3-[(S)-7-Chloro-5-(2-fluoro-phenyl)-2-methylamino-3H-benzo[e][1,4]diazepin-3-yl]-propionic acid methyl ester::CHEMBL109507 Translocator protein Rattus norvegicus 96 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120345 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120345&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 9930172 104013466 CHEMBL109507 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217982 COC(=O)CC[C@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2-n2c(C)ncc12 |t:7| InChI=1S/C22H19ClFN3O2/c1-13-25-12-20-18(8-10-21(28)29-2)26-22(15-5-3-4-6-17(15)24)16-11-14(23)7-9-19(16)27(13)20/h3-7,9,11-12,18H,8,10H2,1-2H3 MCTILYQGJNAZGL-UHFFFAOYSA-N 50120346 3-[(R)-8-Chloro-6-(2-fluoro-phenyl)-1-methyl-4H-2,5,10b-triaza-benzo[e]azulen-4-yl]-propionic acid methyl ester::CHEMBL108709 Translocator protein Rattus norvegicus 3572 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120346 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120346&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338888 104013467 CHEMBL108709 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217983 COC(=O)CC[C@@H]1N=C(c2ccccn2)c2cc(Cl)ccc2NC1=O |t:7| InChI=1S/C18H16ClN3O3/c1-25-16(23)8-7-15-18(24)22-13-6-5-11(19)10-12(13)17(21-15)14-4-2-3-9-20-14/h2-6,9-10,15H,7-8H2,1H3,(H,22,24) ISCVOCJAPVYKDF-UHFFFAOYSA-N 50120347 3-((S)-7-Chloro-2-oxo-5-pyridin-2-yl-2,3-dihydro-1H-benzo[e][1,4]diazepin-3-yl)-propionic acid methyl ester::CHEMBL108446 Translocator protein Rattus norvegicus 139 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120347 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120347&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338869 104013468 CHEMBL108446 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217984 CNC1=Nc2ccc(Cl)cc2C(c2ccccc2)=[N+]([O-])C1 |t:2,19| InChI=1S/C16H14ClN3O/c1-18-15-10-20(21)16(11-5-3-2-4-6-11)13-9-12(17)7-8-14(13)19-15/h2-9H,10H2,1H3,(H,18,19) ANTSCNMPPGJYLG-UHFFFAOYSA-N 50007664 clopoxide::CDP::7-chloro-N-methyl-5-phenyl-3H-1,4-benzodiazepin-2-amine 4-oxide::CHEMBL451::methaminodiazepoxide::7-chloro-2-methylamino-5-phenyl-3H-1,4-benzodiazepin-4-oxide::CHLORDIAZEPOXIDE Translocator protein Rattus norvegicus 438 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50007664 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50007664&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 2712 103920934 CHEMBL451 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217985 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2N=C1NCC(C)C |c:25,t:7| InChI=1S/C23H25ClFN3O2/c1-14(2)13-26-23-20(10-11-21(29)30-3)27-22(16-6-4-5-7-18(16)25)17-12-15(24)8-9-19(17)28-23/h4-9,12,14,20H,10-11,13H2,1-3H3,(H,26,28) LABJSQIPPYBZHJ-UHFFFAOYSA-N 50120348 3-[(S)-7-Chloro-5-(2-fluoro-phenyl)-2-isobutylamino-3H-benzo[e][1,4]diazepin-3-yl]-propionic acid methyl ester::CHEMBL110953 Translocator protein Rattus norvegicus 1012 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120348 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120348&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338898 104013469 CHEMBL110953 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217986 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2N=C1NCc1ccccc1 |c:25,t:7| InChI=1S/C26H23ClFN3O2/c1-33-24(32)14-13-23-26(29-16-17-7-3-2-4-8-17)31-22-12-11-18(27)15-20(22)25(30-23)19-9-5-6-10-21(19)28/h2-12,15,23H,13-14,16H2,1H3,(H,29,31) ZSYGEXDWGPENEH-UHFFFAOYSA-N 50120350 3-[(S)-2-Benzylamino-7-chloro-5-(2-fluoro-phenyl)-3H-benzo[e][1,4]diazepin-3-yl]-propionic acid methyl ester::CHEMBL109694 Translocator protein Rattus norvegicus 875 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120350 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120350&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338899 104013471 CHEMBL109694 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217987 CCNC1=Nc2ccc(Cl)cc2C(=N[C@H]1CCC(=O)OC)c1ccccc1F |c:13,t:3| InChI=1S/C21H21ClFN3O2/c1-3-24-21-18(10-11-19(27)28-2)25-20(14-6-4-5-7-16(14)23)15-12-13(22)8-9-17(15)26-21/h4-9,12,18H,3,10-11H2,1-2H3,(H,24,26) CMTPOUIUNLRIKT-UHFFFAOYSA-N 50120349 3-[(S)-7-Chloro-2-ethylamino-5-(2-fluoro-phenyl)-3H-benzo[e][1,4]diazepin-3-yl]-propionic acid methyl ester::CHEMBL111073 Translocator protein Rattus norvegicus 146 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120349 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120349&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338855 104013470 CHEMBL111073 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217988 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2N=C1NCCO |c:25,t:7| InChI=1S/C21H21ClFN3O3/c1-29-19(28)9-8-18-21(24-10-11-27)26-17-7-6-13(22)12-15(17)20(25-18)14-4-2-3-5-16(14)23/h2-7,12,18,27H,8-11H2,1H3,(H,24,26) BMYFKWDDEMLFIV-UHFFFAOYSA-N 50120351 3-[(S)-7-Chloro-5-(2-fluoro-phenyl)-2-(2-hydroxy-ethylamino)-3H-benzo[e][1,4]diazepin-3-yl]-propionic acid methyl ester::CHEMBL321595 Translocator protein Rattus norvegicus 303 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120351 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120351&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338866 104013472 CHEMBL321595 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217989 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2N=C1NCCc1cnc[nH]1 |c:25,t:7| InChI=1S/C24H23ClFN5O2/c1-33-22(32)9-8-21-24(28-11-10-16-13-27-14-29-16)31-20-7-6-15(25)12-18(20)23(30-21)17-4-2-3-5-19(17)26/h2-7,12-14,21H,8-11H2,1H3,(H,27,29)(H,28,31) OEXCJJPZQHATQG-UHFFFAOYSA-N 50120352 3-{(S)-7-Chloro-5-(2-fluoro-phenyl)-2-[2-(1H-imidazol-4-yl)-ethylamino]-3H-benzo[e][1,4]diazepin-3-yl}-propionic acid methyl ester::CHEMBL326440 Translocator protein Rattus norvegicus 208 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120352 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120352&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338919 104013473 CHEMBL326440 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217990 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2N=C1NCc1ccncc1 |c:25,t:7| InChI=1S/C25H22ClFN4O2/c1-33-23(32)9-8-22-25(29-15-16-10-12-28-13-11-16)31-21-7-6-17(26)14-19(21)24(30-22)18-4-2-3-5-20(18)27/h2-7,10-14,22H,8-9,15H2,1H3,(H,29,31) UANMLAPAUQRVHJ-UHFFFAOYSA-N 50120356 3-{(S)-7-Chloro-5-(2-fluoro-phenyl)-2-[(pyridin-4-ylmethyl)-amino]-3H-benzo[e][1,4]diazepin-3-yl}-propionic acid methyl ester::CHEMBL109187 Translocator protein Rattus norvegicus 1230 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120356 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120356&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338876 104013477 CHEMBL109187 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217991 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2N=C1NCCc1ccncc1 |c:25,t:7| InChI=1S/C26H24ClFN4O2/c1-34-24(33)9-8-23-26(30-15-12-17-10-13-29-14-11-17)32-22-7-6-18(27)16-20(22)25(31-23)19-4-2-3-5-21(19)28/h2-7,10-11,13-14,16,23H,8-9,12,15H2,1H3,(H,30,32) UCVRBCJUBLXBOT-UHFFFAOYSA-N 50120355 3-[(S)-7-Chloro-5-(2-fluoro-phenyl)-2-(2-pyridin-4-yl-ethylamino)-3H-benzo[e][1,4]diazepin-3-yl]-propionic acid methyl ester::CHEMBL321596 Translocator protein Rattus norvegicus 792 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120355 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120355&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338889 104013476 CHEMBL321596 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217992 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2-n2ccnc12 |t:7| InChI=1S/C21H17ClFN3O2/c1-28-19(27)9-7-17-21-24-10-11-26(21)18-8-6-13(22)12-15(18)20(25-17)14-4-2-3-5-16(14)23/h2-6,8,10-12,17H,7,9H2,1H3 SWYFQJGWUBNZHT-UHFFFAOYSA-N 50120353 3-[(S)-8-Chloro-6-(2-fluoro-phenyl)-4H-3,5,10b-triaza-benzo[e]azulen-4-yl]-propionic acid methyl ester::CHEMBL111633 Translocator protein Rattus norvegicus 7 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120353 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120353&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 9800970 104013474 CHEMBL111633 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217993 Cc1ncc2CN=C(c3ccccc3F)c3cc(Cl)ccc3-n12 |t:6| InChI=1S/C18H13ClFN3/c1-11-21-9-13-10-22-18(14-4-2-3-5-16(14)20)15-8-12(19)6-7-17(15)23(11)13/h2-9H,10H2,1H3 DDLIGBOFAVUZHB-UHFFFAOYSA-N 21363 12-chloro-9-(2-fluorophenyl)-3-methyl-2,4,8-triazatricyclo[8.4.0.0^{2,6}]tetradeca-1(10),3,5,8,11,13-hexaene::8-chloro-6-(2-fluorophenyl)-1-methyl-4H-imidazo[1,5-a][1,4]benzodiazepine::Dormicum::CHEMBL655::Ro 21-3981::Midazolam::US20230416258, Compound Midazolam::US20240190889, Example Midazolam::US20240270744, Example Midazolam::US12344614, Example Midazolam::US12365687, Example Midazolam Translocator protein Rattus norvegicus 2 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=21363 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=21363&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 4192 49689435 CHEMBL655 DB00683 C07524 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217994 COC(=O)CC[C@@H]1N=C(c2ccccn2)c2cc(Cl)ccc2-n2c(C)c(C)nc12 |t:7| InChI=1S/C22H21ClN4O2/c1-13-14(2)27-19-9-7-15(23)12-16(19)21(17-6-4-5-11-24-17)26-18(22(27)25-13)8-10-20(28)29-3/h4-7,9,11-12,18H,8,10H2,1-3H3 FJYMKPSNPVCHLQ-UHFFFAOYSA-N 50120354 3-((S)-8-Chloro-1,2-dimethyl-6-pyridin-2-yl-4H-3,5,10b-triaza-benzo[e]azulen-4-yl)-propionic acid methyl ester::CHEMBL111030 Translocator protein Rattus norvegicus 130 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120354 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120354&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338896 104013475 CHEMBL111030 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217995 COC(=O)CC[C@@H]1N=C(c2ccccn2)c2cc(Cl)ccc2-n2c(C)cnc12 |t:7| InChI=1S/C21H19ClN4O2/c1-13-12-24-21-17(7-9-19(27)28-2)25-20(16-5-3-4-10-23-16)15-11-14(22)6-8-18(15)26(13)21/h3-6,8,10-12,17H,7,9H2,1-2H3 JGJJRQMHCYZKQT-UHFFFAOYSA-N 50120358 3-((S)-8-Chloro-1-methyl-6-pyridin-2-yl-4H-3,5,10b-triaza-benzo[e]azulen-4-yl)-propionic acid methyl ester::CHEMBL322701 Translocator protein Rattus norvegicus 98 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120358 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120358&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338904 104013479 CHEMBL322701 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217996 COC(=O)CC[C@@H]1N=C(c2ccccn2)c2cc(Cl)ccc2-n2ccnc12 |t:7| InChI=1S/C20H17ClN4O2/c1-27-18(26)8-6-16-20-23-10-11-25(20)17-7-5-13(21)12-14(17)19(24-16)15-4-2-3-9-22-15/h2-5,7,9-12,16H,6,8H2,1H3 ZJGOOUMHKXGWSN-UHFFFAOYSA-N 50120357 3-((S)-8-Chloro-6-pyridin-2-yl-4H-3,5,10b-triaza-benzo[e]azulen-4-yl)-propionic acid methyl ester::CHEMBL111056 Translocator protein Rattus norvegicus 79 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120357 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120357&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10249237 104013478 CHEMBL111056 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217997 COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2-n2c(C)cnc12 |t:7| InChI=1S/C22H19ClFN3O2/c1-13-12-25-22-18(8-10-20(28)29-2)26-21(15-5-3-4-6-17(15)24)16-11-14(23)7-9-19(16)27(13)22/h3-7,9,11-12,18H,8,10H2,1-2H3 GCVWKECVGWHUEU-UHFFFAOYSA-N 50120360 3-[(S)-8-Chloro-6-(2-fluoro-phenyl)-1-methyl-4H-3,5,10b-triaza-benzo[e]azulen-4-yl]-propionic acid methyl ester::CHEMBL321824 Translocator protein Rattus norvegicus 8 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120360 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120360&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 9801745 104013481 CHEMBL321824 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217998 CNC1=Nc2ccc(Cl)cc2C(=N[C@H]1CCC(=O)OC)c1ccccn1 |c:12,t:2| InChI=1S/C19H19ClN4O2/c1-21-19-16(8-9-17(25)26-2)23-18(15-5-3-4-10-22-15)13-11-12(20)6-7-14(13)24-19/h3-7,10-11,16H,8-9H2,1-2H3,(H,21,24) XNEFJYNPWYKTNA-UHFFFAOYSA-N 50120361 3-((S)-7-Chloro-2-methylamino-5-pyridin-2-yl-3H-benzo[e][1,4]diazepin-3-yl)-propionic acid methyl ester::CHEMBL111701 Translocator protein Rattus norvegicus 1075 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120361 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120361&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338862 104013482 CHEMBL111701 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50217999 COC(=O)CC[C@@H]1N=C(c2ccccn2)c2cc(Cl)ccc2-n2cc(C)nc12 |t:7| InChI=1S/C21H19ClN4O2/c1-13-12-26-18-8-6-14(22)11-15(18)20(16-5-3-4-10-23-16)25-17(21(26)24-13)7-9-19(27)28-2/h3-6,8,10-12,17H,7,9H2,1-2H3 RUNNVRAUZDLQQZ-UHFFFAOYSA-N 50120359 3-((S)-8-Chloro-2-methyl-6-pyridin-2-yl-4H-3,5,10b-triaza-benzo[e]azulen-4-yl)-propionic acid methyl ester::CHEMBL325802 Translocator protein Rattus norvegicus 60 ChEMBL 10.1016/s0960-894x(02)00513-9 10.7270/Q2GQ6X4F 12372538 Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL 10/9/2002 11/10/2009 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50120359 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50120359&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 44338905 104013480 CHEMBL325802 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257