BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50210783 CS(=O)(=O)n1c2ccccc2c2cc(NC(=O)CCc3ccncc3)ccc12 InChI=1S/C21H19N3O3S/c1-28(26,27)24-19-5-3-2-4-17(19)18-14-16(7-8-20(18)24)23-21(25)9-6-15-10-12-22-13-11-15/h2-5,7-8,10-14H,6,9H2,1H3,(H,23,25) IXOGWBZUTOHTBT-UHFFFAOYSA-N 50116590 N-(9-Methanesulfonyl-9H-carbazol-3-yl)-3-pyridin-4-yl-propionamide::CHEMBL325486 Neuropeptide Y receptor type 5 Homo sapiens 1 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116590 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116590&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11111992 104010265 CHEMBL325486 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210784 CCn1c2ccccc2c2cc(CC(=O)NCc3ccncc3)ccc12 InChI=1S/C22H21N3O/c1-2-25-20-6-4-3-5-18(20)19-13-17(7-8-21(19)25)14-22(26)24-15-16-9-11-23-12-10-16/h3-13H,2,14-15H2,1H3,(H,24,26) ZOTAHNAPXDAJDO-UHFFFAOYSA-N 50116591 2-(9-Ethyl-9H-carbazol-3-yl)-N-pyridin-4-ylmethyl-acetamide::CHEMBL115911 Neuropeptide Y receptor type 5 Homo sapiens 2250 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116591 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116591&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11110676 104010266 CHEMBL115911 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210785 CCn1c2ccccc2c2ccc(NC(=O)CCc3ccncc3)cc12 InChI=1S/C22H21N3O/c1-2-25-20-6-4-3-5-18(20)19-9-8-17(15-21(19)25)24-22(26)10-7-16-11-13-23-14-12-16/h3-6,8-9,11-15H,2,7,10H2,1H3,(H,24,26) IDFJNVMQFAKDBG-UHFFFAOYSA-N 50116593 N-(9-Ethyl-9H-carbazol-2-yl)-3-pyridin-4-yl-propionamide::CHEMBL115690 Neuropeptide Y receptor type 5 Homo sapiens 800 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116593 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116593&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11099994 104010268 CHEMBL115690 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210786 CC(C)n1c2ccccc2c2c(C)c(NC(=O)N3CCOCC3)ccc12 InChI=1S/C21H25N3O2/c1-14(2)24-18-7-5-4-6-16(18)20-15(3)17(8-9-19(20)24)22-21(25)23-10-12-26-13-11-23/h4-9,14H,10-13H2,1-3H3,(H,22,25) ZNFMHLDBJPAFEQ-UHFFFAOYSA-N 50116592 Morpholine-4-carboxylic acid (9-isopropyl-4-methyl-9H-carbazol-3-yl)-amide::CHEMBL325226 Neuropeptide Y receptor type 5 Homo sapiens 3 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116592 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116592&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 9884833 104010267 CHEMBL325226 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210787 CCn1c2ccccc2c2cc(ccc12)N(C)C(=O)CCc1ccncc1 InChI=1S/C23H23N3O/c1-3-26-21-7-5-4-6-19(21)20-16-18(9-10-22(20)26)25(2)23(27)11-8-17-12-14-24-15-13-17/h4-7,9-10,12-16H,3,8,11H2,1-2H3 WKPMXAVSUXUVNO-UHFFFAOYSA-N 50116595 N-(9-Ethyl-9H-carbazol-3-yl)-N-methyl-3-pyridin-4-yl-propionamide::CHEMBL435384 Neuropeptide Y receptor type 5 Homo sapiens 2200 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116595 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116595&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10970360 104010270 CHEMBL435384 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210788 CCOc1c(NC(=O)N2CCOCC2)ccc2n(C(C)C)c3ccccc3c12 InChI=1S/C22H27N3O3/c1-4-28-21-17(23-22(26)24-11-13-27-14-12-24)9-10-19-20(21)16-7-5-6-8-18(16)25(19)15(2)3/h5-10,15H,4,11-14H2,1-3H3,(H,23,26) FCQZLKZHAWYZED-UHFFFAOYSA-N 50116594 Morpholine-4-carboxylic acid (4-ethoxy-9-isopropyl-9H-carbazol-3-yl)-amide::CHEMBL118098 Neuropeptide Y receptor type 5 Homo sapiens 270 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116594 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116594&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11143423 104010269 CHEMBL118098 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210789 CCn1c2ccccc2c2c(NC(=O)CCc3ccncc3)cccc12 InChI=1S/C22H21N3O/c1-2-25-19-8-4-3-6-17(19)22-18(7-5-9-20(22)25)24-21(26)11-10-16-12-14-23-15-13-16/h3-9,12-15H,2,10-11H2,1H3,(H,24,26) CIPLXHNAONEVNM-UHFFFAOYSA-N 50116596 N-(9-Ethyl-9H-carbazol-4-yl)-3-pyridin-4-yl-propionamide::CHEMBL331581 Neuropeptide Y receptor type 5 Homo sapiens >10000 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116596 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116596&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10947900 104010271 CHEMBL331581 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210790 CCn1c2ccccc2c2cc(NC(=O)N3CCOCC3)ccc12 InChI=1S/C19H21N3O2/c1-2-22-17-6-4-3-5-15(17)16-13-14(7-8-18(16)22)20-19(23)21-9-11-24-12-10-21/h3-8,13H,2,9-12H2,1H3,(H,20,23) LHOFTARJKUMVFG-UHFFFAOYSA-N 50116597 Morpholine-4-carboxylic acid (9-ethyl-9H-carbazol-3-yl)-amide::CHEMBL119247 Neuropeptide Y receptor type 5 Homo sapiens 7 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116597 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116597&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 1639804 104010272 CHEMBL119247 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210791 CC(C)n1c2ccccc2c2c(C)c(NC(=O)N3CCOCC3)c(C)cc12 InChI=1S/C22H27N3O2/c1-14(2)25-18-8-6-5-7-17(18)20-16(4)21(15(3)13-19(20)25)23-22(26)24-9-11-27-12-10-24/h5-8,13-14H,9-12H2,1-4H3,(H,23,26) BHTJQQZHOZWIRO-UHFFFAOYSA-N 50116599 Morpholine-4-carboxylic acid (9-isopropyl-2,4-dimethyl-9H-carbazol-3-yl)-amide::CHEMBL119726 Neuropeptide Y receptor type 5 Homo sapiens 390 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116599 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116599&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11035908 104010274 CHEMBL119726 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210792 O=C(CSc1ccncc1)Nc1ccc(cc1)C(=O)c1ccccc1 InChI=1S/C20H16N2O2S/c23-19(14-25-18-10-12-21-13-11-18)22-17-8-6-16(7-9-17)20(24)15-4-2-1-3-5-15/h1-13H,14H2,(H,22,23) YFONOXVYUGNQML-UHFFFAOYSA-N 50116598 N-(4-Benzoyl-phenyl)-2-(pyridin-4-ylsulfanyl)-acetamide::CHEMBL331019 Neuropeptide Y receptor type 5 Homo sapiens 350 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116598 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116598&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44344734 104010273 CHEMBL331019 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210793 CCn1c2ccccc2c2cc(NC(=O)CCc3ccncc3)ccc12 InChI=1S/C22H21N3O/c1-2-25-20-6-4-3-5-18(20)19-15-17(8-9-21(19)25)24-22(26)10-7-16-11-13-23-14-12-16/h3-6,8-9,11-15H,2,7,10H2,1H3,(H,24,26) STJCFOPXJIECBK-UHFFFAOYSA-N 50116600 N-(9-Ethyl-9H-carbazol-3-yl)-3-pyridin-4-yl-propionamide::CHEMBL325475 Neuropeptide Y receptor type 5 Homo sapiens 2 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116600 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116600&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10969955 104010275 CHEMBL325475 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210794 CC(C)c1c(NC(=O)N2CCOCC2)ccc2n(C(C)C)c3ccccc3c12 InChI=1S/C23H29N3O2/c1-15(2)21-18(24-23(27)25-11-13-28-14-12-25)9-10-20-22(21)17-7-5-6-8-19(17)26(20)16(3)4/h5-10,15-16H,11-14H2,1-4H3,(H,24,27) OKLLIYLFTVZZKR-UHFFFAOYSA-N 50116601 Morpholine-4-carboxylic acid (4,9-diisopropyl-9H-carbazol-3-yl)-amide::CHEMBL118710 Neuropeptide Y receptor type 5 Homo sapiens 770 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116601 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116601&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10926986 104010276 CHEMBL118710 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210795 CC(C)n1c2ccccc2c2cc(NC(=O)N3CCOCC3)ccc12 InChI=1S/C20H23N3O2/c1-14(2)23-18-6-4-3-5-16(18)17-13-15(7-8-19(17)23)21-20(24)22-9-11-25-12-10-22/h3-8,13-14H,9-12H2,1-2H3,(H,21,24) AVKGWXGSJRJBHL-UHFFFAOYSA-N 50116602 Morpholine-4-carboxylic acid (9-isopropyl-9H-carbazol-3-yl)-amide::CHEMBL419951 Neuropeptide Y receptor type 5 Homo sapiens 2 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116602 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116602&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 9862646 104010277 CHEMBL419951 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210796 CC(C)n1c2ccccc2c2c(C)c(NC(=O)N3CCOCC3)ccc12 InChI=1S/C21H25N3O2/c1-14(2)24-18-7-5-4-6-16(18)20-15(3)17(8-9-19(20)24)22-21(25)23-10-12-26-13-11-23/h4-9,14H,10-13H2,1-3H3,(H,22,25) ZNFMHLDBJPAFEQ-UHFFFAOYSA-N 50116592 Morpholine-4-carboxylic acid (9-isopropyl-4-methyl-9H-carbazol-3-yl)-amide::CHEMBL325226 Neuropeptide Y receptor type 5 Homo sapiens 6 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116592 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116592&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 9884833 104010267 CHEMBL325226 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210797 CS(=O)(=O)n1c2ccccc2c2cc(NC(=O)N3CCOCC3)ccc12 InChI=1S/C18H19N3O4S/c1-26(23,24)21-16-5-3-2-4-14(16)15-12-13(6-7-17(15)21)19-18(22)20-8-10-25-11-9-20/h2-7,12H,8-11H2,1H3,(H,19,22) XPYOMEVUZBGHLA-UHFFFAOYSA-N 50116603 Morpholine-4-carboxylic acid (9-methanesulfonyl-9H-carbazol-3-yl)-amide::CHEMBL443809 Neuropeptide Y receptor type 5 Homo sapiens 15 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116603 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116603&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10883239 104010278 CHEMBL443809 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210798 CC(C)n1c2ccccc2c2c(C)c(NC(=O)N3CCOCC3)ccc12 InChI=1S/C21H25N3O2/c1-14(2)24-18-7-5-4-6-16(18)20-15(3)17(8-9-19(20)24)22-21(25)23-10-12-26-13-11-23/h4-9,14H,10-13H2,1-3H3,(H,22,25) ZNFMHLDBJPAFEQ-UHFFFAOYSA-N 50116592 Morpholine-4-carboxylic acid (9-isopropyl-4-methyl-9H-carbazol-3-yl)-amide::CHEMBL325226 Neuropeptide Y receptor type 5 Homo sapiens 37 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116592 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116592&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 9884833 104010267 CHEMBL325226 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210799 O=C(CCc1ccncc1)Nc1ccc(cc1)C(=O)c1ccccc1 InChI=1S/C21H18N2O2/c24-20(11-6-16-12-14-22-15-13-16)23-19-9-7-18(8-10-19)21(25)17-4-2-1-3-5-17/h1-5,7-10,12-15H,6,11H2,(H,23,24) GQNUYOCQSJEZFY-UHFFFAOYSA-N 50116604 N-(4-Benzoyl-phenyl)-3-pyridin-4-yl-propionamide::CHEMBL327151 Neuropeptide Y receptor type 5 Homo sapiens 300 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116604 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116604&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44344633 104010279 CHEMBL327151 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210800 CC(C)n1c2ccccc2c2c(F)c(NC(=O)N3CCOCC3)c(F)cc12 InChI=1S/C20H21F2N3O2/c1-12(2)25-15-6-4-3-5-13(15)17-16(25)11-14(21)19(18(17)22)23-20(26)24-7-9-27-10-8-24/h3-6,11-12H,7-10H2,1-2H3,(H,23,26) RTALAECPNZHYMK-UHFFFAOYSA-N 50116607 Morpholine-4-carboxylic acid (2,4-difluoro-9-isopropyl-9H-carbazol-3-yl)-amide::CHEMBL325639 Neuropeptide Y receptor type 5 Homo sapiens 12 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116607 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116607&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11783658 104010282 CHEMBL325639 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210801 CCn1c2ccccc2c2cc(ccc12)C(=O)NCCc1ccncc1 InChI=1S/C22H21N3O/c1-2-25-20-6-4-3-5-18(20)19-15-17(7-8-21(19)25)22(26)24-14-11-16-9-12-23-13-10-16/h3-10,12-13,15H,2,11,14H2,1H3,(H,24,26) IOFIZWDNAAFVLM-UHFFFAOYSA-N 50116606 9-Ethyl-9H-carbazole-3-carboxylic acid (2-pyridin-4-yl-ethyl)-amide::CHEMBL326491 Neuropeptide Y receptor type 5 Homo sapiens 700 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116606 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116606&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10958843 104010281 CHEMBL326491 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210802 CC(C)n1c2ccc(F)cc2c2cc(NC(=O)N3CCOCC3)ccc12 InChI=1S/C20H22FN3O2/c1-13(2)24-18-5-3-14(21)11-16(18)17-12-15(4-6-19(17)24)22-20(25)23-7-9-26-10-8-23/h3-6,11-13H,7-10H2,1-2H3,(H,22,25) NYSQQEAGMVLKLA-UHFFFAOYSA-N 50116605 Morpholine-4-carboxylic acid (6-fluoro-9-isopropyl-9H-carbazol-3-yl)-amide::CHEMBL432628 Neuropeptide Y receptor type 5 Homo sapiens 3 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116605 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116605&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11002751 104010280 CHEMBL432628 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210803 CN(C)S(=O)(=O)n1c2ccccc2c2cc(NC(=O)CCc3ccncc3)ccc12 InChI=1S/C22H22N4O3S/c1-25(2)30(28,29)26-20-6-4-3-5-18(20)19-15-17(8-9-21(19)26)24-22(27)10-7-16-11-13-23-14-12-16/h3-6,8-9,11-15H,7,10H2,1-2H3,(H,24,27) OOSJJJCTOBOPML-UHFFFAOYSA-N 50116608 N-(9-Dimethylsulfamoyl-9H-carbazol-3-yl)-3-pyridin-4-yl-propionamide::CHEMBL117922 Neuropeptide Y receptor type 5 Homo sapiens 8 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116608 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116608&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11015360 104010283 CHEMBL117922 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210804 CC(C)n1c2ccccc2c2cc(NC(=O)CCc3ccncc3)ccc12 InChI=1S/C23H23N3O/c1-16(2)26-21-6-4-3-5-19(21)20-15-18(8-9-22(20)26)25-23(27)10-7-17-11-13-24-14-12-17/h3-6,8-9,11-16H,7,10H2,1-2H3,(H,25,27) ISOORHISZYRNCF-UHFFFAOYSA-N 50116610 N-(9-Isopropyl-9H-carbazol-3-yl)-3-pyridin-4-yl-propionamide::CHEMBL119743 Neuropeptide Y receptor type 5 Homo sapiens 1 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116610 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116610&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10926406 104010285 CHEMBL119743 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210805 CC(C)(C)Cn1c2ccccc2c2cc(NC(=O)N3CCOCC3)ccc12 InChI=1S/C22H27N3O2/c1-22(2,3)15-25-19-7-5-4-6-17(19)18-14-16(8-9-20(18)25)23-21(26)24-10-12-27-13-11-24/h4-9,14H,10-13,15H2,1-3H3,(H,23,26) MWXNDJFIIHASJJ-UHFFFAOYSA-N 50116609 Morpholine-4-carboxylic acid [9-(2,2-dimethyl-propyl)-9H-carbazol-3-yl]-amide::CHEMBL119426 Neuropeptide Y receptor type 5 Homo sapiens 78 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116609 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116609&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10893873 104010284 CHEMBL119426 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210806 CC(C)n1c2ccccc2c2c(C)c(NC(=O)N3CCOCC3)cc(C)c12 InChI=1S/C22H27N3O2/c1-14(2)25-19-8-6-5-7-17(19)20-16(4)18(13-15(3)21(20)25)23-22(26)24-9-11-27-12-10-24/h5-8,13-14H,9-12H2,1-4H3,(H,23,26) NPVSYVVVVTWGIO-UHFFFAOYSA-N 50116611 Morpholine-4-carboxylic acid (9-isopropyl-1,4-dimethyl-9H-carbazol-3-yl)-amide::CHEMBL117469 Neuropeptide Y receptor type 5 Homo sapiens 710 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116611 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116611&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11089837 104010286 CHEMBL117469 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210807 Cn1c2ccccc2c2cc(NC(=O)CCc3ccncc3)ccc12 InChI=1S/C21H19N3O/c1-24-19-5-3-2-4-17(19)18-14-16(7-8-20(18)24)23-21(25)9-6-15-10-12-22-13-11-15/h2-5,7-8,10-14H,6,9H2,1H3,(H,23,25) JPDVZFGZORGXAL-UHFFFAOYSA-N 50116612 N-(9-Methyl-9H-carbazol-3-yl)-3-pyridin-4-yl-propionamide::CHEMBL118973 Neuropeptide Y receptor type 5 Homo sapiens 33 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116612 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116612&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10892838 104010287 CHEMBL118973 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210808 O=C(CCc1ccncc1)Nc1ccc2[nH]c3ccccc3c2c1 InChI=1S/C20H17N3O/c24-20(8-5-14-9-11-21-12-10-14)22-15-6-7-19-17(13-15)16-3-1-2-4-18(16)23-19/h1-4,6-7,9-13,23H,5,8H2,(H,22,24) MJWYPTQFKYMTKC-UHFFFAOYSA-N 50116613 N-(9H-Carbazol-3-yl)-3-pyridin-4-yl-propionamide::CHEMBL325666 Neuropeptide Y receptor type 5 Homo sapiens 230 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116613 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116613&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10860014 104010288 CHEMBL325666 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210809 CCn1c2ccccc2c2cc(NC(=O)CCc3ccncc3)ccc12 InChI=1S/C22H21N3O/c1-2-25-20-6-4-3-5-18(20)19-15-17(8-9-21(19)25)24-22(26)10-7-16-11-13-23-14-12-16/h3-6,8-9,11-15H,2,7,10H2,1H3,(H,24,26) STJCFOPXJIECBK-UHFFFAOYSA-N 50116600 N-(9-Ethyl-9H-carbazol-3-yl)-3-pyridin-4-yl-propionamide::CHEMBL325475 Neuropeptide Y receptor type 5 Rattus norvegicus 7 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116600 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000850&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116600&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10969955 104010275 CHEMBL325475 1 MEFKLEEHFNKTFVTENNTAAARNAAFPAWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLQPSKKSRNQAKTPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQGKHLAVPENPASVRSQLSPSSKVIPGVPICFEVKPEESSDAHEMRVKRSITRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS Neuropeptide Y receptor type 5 NPY5R_RAT Q63634 P70586 50210810 CCn1c2ccccc2c2cc(NC(=O)CCc3ccncc3)ccc12 InChI=1S/C22H21N3O/c1-2-25-20-6-4-3-5-18(20)19-15-17(8-9-21(19)25)24-22(26)10-7-16-11-13-23-14-12-16/h3-6,8-9,11-15H,2,7,10H2,1H3,(H,24,26) STJCFOPXJIECBK-UHFFFAOYSA-N 50116600 N-(9-Ethyl-9H-carbazol-3-yl)-3-pyridin-4-yl-propionamide::CHEMBL325475 Neuropeptide Y receptor type 5 Homo sapiens 11 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116600 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116600&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10969955 104010275 CHEMBL325475 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210811 CN(C)S(=O)(=O)n1c2ccccc2c2cc(NC(=O)N3CCOCC3)ccc12 InChI=1S/C19H22N4O4S/c1-21(2)28(25,26)23-17-6-4-3-5-15(17)16-13-14(7-8-18(16)23)20-19(24)22-9-11-27-12-10-22/h3-8,13H,9-12H2,1-2H3,(H,20,24) KDYBUSJRQUZESZ-UHFFFAOYSA-N 50116615 Morpholine-4-carboxylic acid (9-dimethylsulfamoyl-9H-carbazol-3-yl)-amide::CHEMBL324366 Neuropeptide Y receptor type 5 Homo sapiens 350 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116615 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116615&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11003942 104010290 CHEMBL324366 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210812 CCn1c2ccccc2c2cccc(NC(=O)CCc3ccncc3)c12 InChI=1S/C22H21N3O/c1-2-25-20-9-4-3-6-17(20)18-7-5-8-19(22(18)25)24-21(26)11-10-16-12-14-23-15-13-16/h3-9,12-15H,2,10-11H2,1H3,(H,24,26) CCUHKMTUURSZNA-UHFFFAOYSA-N 50116616 N-(9-Ethyl-9H-carbazol-1-yl)-3-pyridin-4-yl-propionamide::CHEMBL117684 Neuropeptide Y receptor type 5 Homo sapiens 440 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116616 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116616&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11110677 104010291 CHEMBL117684 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210813 CCn1c2ccccc2c2cc(CNC(=O)Cc3ccncc3)ccc12 InChI=1S/C22H21N3O/c1-2-25-20-6-4-3-5-18(20)19-13-17(7-8-21(19)25)15-24-22(26)14-16-9-11-23-12-10-16/h3-13H,2,14-15H2,1H3,(H,24,26) VMFPRCQHRTWIPD-UHFFFAOYSA-N 50116614 N-(9-Ethyl-9H-carbazol-3-ylmethyl)-2-pyridin-4-yl-acetamide::CHEMBL117626 Neuropeptide Y receptor type 5 Homo sapiens 3400 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116614 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116614&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11067876 104010289 CHEMBL117626 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210814 CC(=O)n1c2ccccc2c2cc(NC(=O)CCc3ccncc3)ccc12 InChI=1S/C22H19N3O2/c1-15(26)25-20-5-3-2-4-18(20)19-14-17(7-8-21(19)25)24-22(27)9-6-16-10-12-23-13-11-16/h2-5,7-8,10-14H,6,9H2,1H3,(H,24,27) BLJIZWQCQUDUGF-UHFFFAOYSA-N 50116617 N-(9-Acetyl-9H-carbazol-3-yl)-3-pyridin-4-yl-propionamide::CHEMBL116210 Neuropeptide Y receptor type 5 Homo sapiens 3 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116617 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116617&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 11824465 104010292 CHEMBL116210 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210815 CC(C)n1c2ccc(NC(=O)N3CCOCC3)cc2c2cccc(C)c12 InChI=1S/C21H25N3O2/c1-14(2)24-19-8-7-16(22-21(25)23-9-11-26-12-10-23)13-18(19)17-6-4-5-15(3)20(17)24/h4-8,13-14H,9-12H2,1-3H3,(H,22,25) GYHIXYWTIRXOOU-UHFFFAOYSA-N 50116619 Morpholine-4-carboxylic acid (9-isopropyl-8-methyl-9H-carbazol-3-yl)-amide::CHEMBL117563 Neuropeptide Y receptor type 5 Homo sapiens 2 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116619 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116619&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10970192 104010294 CHEMBL117563 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50210816 O=C(Nc1ccc2n(C3CCOC3)c3ccccc3c2c1)N1CCOCC1 InChI=1S/C21H23N3O3/c25-21(23-8-11-26-12-9-23)22-15-5-6-20-18(13-15)17-3-1-2-4-19(17)24(20)16-7-10-27-14-16/h1-6,13,16H,7-12,14H2,(H,22,25) ABHPYCROGZZOEB-UHFFFAOYSA-N 50116618 Morpholine-4-carboxylic acid [9-(tetrahydro-furan-3-yl)-9H-carbazol-3-yl]-amide::CHEMBL324028 Neuropeptide Y receptor type 5 Homo sapiens 40 ChEMBL 10.1021/jm011125x 10.7270/Q27S7N3K 12139462 Block, MH; Boyer, S; Brailsford, W; Brittain, DR; Carroll, D; Chapman, S; Clarke, DS; Donald, CS; Foote, KM; Godfrey, L; Ladner, A; Marsham, PR; Masters, DJ; Mee, CD; O'Donovan, MR; Pease, JE; Pickup, AG; Rayner, JW; Roberts, A; Schofield, P; Suleman, A; Turnbull, AV 7/25/2002 11/10/2009 Astrazeneca http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50116618 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50116618&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44344629 104010293 CHEMBL324028 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916