BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 14693 COC(=O)CC1Nc2ccc(cc2CN(C)C1=O)C(=O)N(C)Cc1cc2ccccc2n1C InChI=1S/C25H28N4O4/c1-27-14-18-11-17(9-10-20(18)26-21(25(27)32)13-23(30)33-4)24(31)28(2)15-19-12-16-7-5-6-8-22(16)29(19)3/h5-12,21,26H,13-15H2,1-4H3 SMHQHIYGXNMNCE-UHFFFAOYSA-N 8712 methyl 2-(4-methyl-7-{methyl[(1-methyl-1H-indol-2-yl)methyl]carbamoyl}-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepin-2-yl)acetate::1,4-Benzodiazepine deriv. 1 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 16500 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8712 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8712&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539881 11109452 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14694 COC(=O)C[C@H]1Nc2ccc(cc2CN(C)C1=O)C(=O)N(C)Cc1cc2ccccc2n1C |r| InChI=1S/C25H28N4O4/c1-27-14-18-11-17(9-10-20(18)26-21(25(27)32)13-23(30)33-4)24(31)28(2)15-19-12-16-7-5-6-8-22(16)29(19)3/h5-12,21,26H,13-15H2,1-4H3 SMHQHIYGXNMNCE-UHFFFAOYSA-N 8713 methyl 2-[(2R)-4-methyl-7-{methyl[(1-methyl-1H-indol-2-yl)methyl]carbamoyl}-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepin-2-yl]acetate::(2R)-2-[(Carbomethoxy)methyl]-N,4-dimethyl-N-(1-methyl-1H-indol-2-ylmethyl)-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepine-7-carboxamide::1,4-Benzodiazepine deriv. 2 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 9900 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8713 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8713&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539882 11109453 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14695 COC(=O)C[C@@H]1Nc2ccc(cc2CN(C)C1=O)C(=O)N(C)Cc1cc2ccccc2n1C |r| InChI=1S/C25H28N4O4/c1-27-14-18-11-17(9-10-20(18)26-21(25(27)32)13-23(30)33-4)24(31)28(2)15-19-12-16-7-5-6-8-22(16)29(19)3/h5-12,21,26H,13-15H2,1-4H3 SMHQHIYGXNMNCE-UHFFFAOYSA-N 8714 (2S)-2-[(Carbomethoxy)methyl]-N,4-dimethyl-N-(1-methyl-1H-indol-2-ylmethyl)-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepine-7-carboxamide::methyl 2-[(2S)-4-methyl-7-{methyl[(1-methyl-1H-indol-2-yl)methyl]carbamoyl}-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepin-2-yl]acetate::1,4-Benzodiazepine deriv. 3 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 676000 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8714 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8714&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539883 11109454 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14696 CN(Cc1cc2ccccc2n1C)C(=O)c1ccc2NCC(=O)N(C)Cc2c1 InChI=1S/C22H24N4O2/c1-24-13-17-10-16(8-9-19(17)23-12-21(24)27)22(28)25(2)14-18-11-15-6-4-5-7-20(15)26(18)3/h4-11,23H,12-14H2,1-3H3 WOHJDBQRHPBJCQ-UHFFFAOYSA-N 8715 N,4-Dimethyl-N-(1-methyl-1H-indol-2-ylmethyl)-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepine-7-carboxamide::N,4-dimethyl-N-[(1-methyl-1H-indol-2-yl)methyl]-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepine-7-carboxamide::1,4-Benzodiazepine deriv. 4 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 21200 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8715 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8715&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539884 11109455 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14697 CC(=O)N(C)Cc1cc(ccc1N)C(=O)N(C)Cc2cc3ccccc3n2C InChI=1S/C22H26N4O2/c1-15(27)24(2)13-18-11-17(9-10-20(18)23)22(28)25(3)14-19-12-16-7-5-6-8-21(16)26(19)4/h5-12H,13-14,23H2,1-4H3 AWTBJNJPBKTHEV-UHFFFAOYSA-N 8716 3-[(N-Acetyl-N-methylamino)methyl]-4-amino-N-methyl-N-(1-methyl-1H-indol-2-ylmethyl)benzamide::4-amino-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]-3-[(N-methylacetamido)methyl]benzamide::benzamide deriv. 5 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 6700 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8716 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8716&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search ZAM 1LX6 447018 11109456 DB03534 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14698 CN(Cc1cc2ccccc2n1C)C(=O)c1cccc(CN(C)C(C)=O)c1 InChI=1S/C22H25N3O2/c1-16(26)23(2)14-17-8-7-10-19(12-17)22(27)24(3)15-20-13-18-9-5-6-11-21(18)25(20)4/h5-13H,14-15H2,1-4H3 RMNMNSNCWZYBEG-UHFFFAOYSA-N 8717 3-[(N-Acetyl-N-methylamino)methyl]-N-methyl-N-(1-methyl-1H-indol-2-ylmethyl)benzamide::N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]-3-[(N-methylacetamido)methyl]benzamide::benzamide deriv. 6 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 107000 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8717 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8717&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539885 11109457 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14699 CN(Cc1cc2ccccc2n1C)C(=O)c1ccc(N)cc1 InChI=1S/C18H19N3O/c1-20(18(22)13-7-9-15(19)10-8-13)12-16-11-14-5-3-4-6-17(14)21(16)2/h3-11H,12,19H2,1-2H3 ZNIKKTWPMSNEAW-UHFFFAOYSA-N 8718 4-Amino-N-methyl-N-(1-methyl-1H-indol-2-ylmethyl)-benzamide::4-amino-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]benzamide::benzamide deriv. 7 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 16300 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8718 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8718&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539886 11109458 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14700 CN(Cc1cc2ccccc2n1C)C(=O)c1ccccc1 InChI=1S/C18H18N2O/c1-19(18(21)14-8-4-3-5-9-14)13-16-12-15-10-6-7-11-17(15)20(16)2/h3-12H,13H2,1-2H3 OSHHQNITRNVSKO-UHFFFAOYSA-N 8719 N-Methyl-N-(1-methyl-1H-indol-2-ylmethyl)benzamide::N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]benzamide::benzamide deriv. 8 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) >100000 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8719 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8719&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539887 11109459 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14701 Cn1c2ccccc2cc1CN(C)C(=O)\C=C\c3ccc(nc3)N InChI=1S/C19H20N4O/c1-22(19(24)10-8-14-7-9-18(20)21-12-14)13-16-11-15-5-3-4-6-17(15)23(16)2/h3-12H,13H2,1-2H3,(H2,20,21) AKFPMLBVLWZSQX-UHFFFAOYSA-N 8720 (2E)-3-(6-aminopyridin-3-yl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]prop-2-enamide::aminopyridine 4::3-(6-Aminopyridin-3-yl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]acrylamide::aminopyridine deriv. 9 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 2400 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8720 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8720&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search AYM 1LXC 5287720 11109460 DB01865 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14702 CN(Cc1cc2ccccc2n1C)C(=O)\C=C\c1cnc(N)nc1 InChI=1S/C18H19N5O/c1-22(17(24)8-7-13-10-20-18(19)21-11-13)12-15-9-14-5-3-4-6-16(14)23(15)2/h3-11H,12H2,1-2H3,(H2,19,20,21) VKFDLGMJTNQANO-UHFFFAOYSA-N 8721 (E)-3-(2-Aminopyrimidin-5-yl)-N-methyl-N-(1-methyl-1H-indol-2-ylmethyl)acrylamide::(2E)-3-(2-aminopyrimidin-5-yl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]prop-2-enamide::aminopyrimidine deriv. 10 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 2200 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8721 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8721&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539888 11109461 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14703 CN(Cc1cc2ccccc2n1C)C(=O)CCc1ccc(N)nc1 InChI=1S/C19H22N4O/c1-22(19(24)10-8-14-7-9-18(20)21-12-14)13-16-11-15-5-3-4-6-17(15)23(16)2/h3-7,9,11-12H,8,10,13H2,1-2H3,(H2,20,21) CAEFFYSYRJMIGG-UHFFFAOYSA-N 8722 3-(6-Aminopyridin-3-yl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]propionamide::3-(6-aminopyridin-3-yl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]propanamide::aminopyridine deriv. 11 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 93700 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8722 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8722&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 447019 11109462 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14704 CN(Cc1cc2ccccc2n1C)C(=O)c1ccc(N)nc1 InChI=1S/C17H18N4O/c1-20(17(22)13-7-8-16(18)19-10-13)11-14-9-12-5-3-4-6-15(12)21(14)2/h3-10H,11H2,1-2H3,(H2,18,19) WUAULDNTPAVINA-UHFFFAOYSA-N 8723 6-amino-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]pyridine-3-carboxamide::6-Amino-N-methyl-N-(1-methyl-1H-indol-2-yl)nicotinamide::aminopyridine deriv. 12 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) >100000 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8723 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8723&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539889 11109463 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14705 CN(Cc1cc2ccccc2n1C)C(=O)\C=C\c1ccc(N)cc1 InChI=1S/C20H21N3O/c1-22(20(24)12-9-15-7-10-17(21)11-8-15)14-18-13-16-5-3-4-6-19(16)23(18)2/h3-13H,14,21H2,1-2H3 JGTLZJKIHHZHOX-UHFFFAOYSA-N 8724 (E)-3-(4-Aminophenyl)-N-methyl-N-(1-methyl-1H-indol-2-ylmethyl)acrylamide::(2E)-3-(4-aminophenyl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]prop-2-enamide::acrylamide deriv. 13 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 11200 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8724 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8724&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539890 11109464 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14706 CN(Cc1cc2ccccc2n1C)C(=O)\C=C\c1cccnc1 InChI=1S/C19H19N3O/c1-21(19(23)10-9-15-6-5-11-20-13-15)14-17-12-16-7-3-4-8-18(16)22(17)2/h3-13H,14H2,1-2H3 LGENXSSEFBSKIU-UHFFFAOYSA-N 8725 (2E)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]-3-(pyridin-3-yl)prop-2-enamide::(E)-N-Methyl-N-(1-methyl-1H-indol-2-ylmethyl)-3-(pyridin-3-yl)acrylamide::aminopyridine deriv. 14 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 14200 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8725 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8725&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539891 11109465 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14707 c1cc(c(cc1Cl)O)Oc2ccc(cc2Cl)Cl InChI=1S/C12H7Cl3O2/c13-7-1-3-11(9(15)5-7)17-12-4-2-8(14)6-10(12)16/h1-6,16H XEFQLINVKFYRCS-UHFFFAOYSA-N 8726 CHEMBL849::TCL::5-chloro-2-(2,4-dichlorophenoxy)phenol::Triclosan::US20230414581, Compound 35 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 70 6.5000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8726 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8726&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search TCL 2O2S,4M89,1UH5,4NR0,3PJF,3PJE,3PJD,6AH9,2O2Y,5YCS,1P45,3OID,3OIF,1QSG,2B35,2QIO,3P9T,3NRC,3GR6,2WYW,1NHG,5IFL,3AM3,3AM5,1D8A,1QG6,1D7O,4W9N,2PD3,1C14,7FCM,4ALL,4ALI 5564 11109466 CHEMBL849 DB08604 C12059 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14708 COC(=O)CC1Nc2ccc(cc2CN(C)C1=O)C(=O)N(C)Cc1cc2ccccc2n1C InChI=1S/C25H28N4O4/c1-27-14-18-11-17(9-10-20(18)26-21(25(27)32)13-23(30)33-4)24(31)28(2)15-19-12-16-7-5-6-8-22(16)29(19)3/h5-12,21,26H,13-15H2,1-4H3 SMHQHIYGXNMNCE-UHFFFAOYSA-N 8712 methyl 2-(4-methyl-7-{methyl[(1-methyl-1H-indol-2-yl)methyl]carbamoyl}-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepin-2-yl)acetate::1,4-Benzodiazepine deriv. 1 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 6900 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8712 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8712&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539881 11109452 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14709 COC(=O)C[C@H]1Nc2ccc(cc2CN(C)C1=O)C(=O)N(C)Cc1cc2ccccc2n1C |r| InChI=1S/C25H28N4O4/c1-27-14-18-11-17(9-10-20(18)26-21(25(27)32)13-23(30)33-4)24(31)28(2)15-19-12-16-7-5-6-8-22(16)29(19)3/h5-12,21,26H,13-15H2,1-4H3 SMHQHIYGXNMNCE-UHFFFAOYSA-N 8713 methyl 2-[(2R)-4-methyl-7-{methyl[(1-methyl-1H-indol-2-yl)methyl]carbamoyl}-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepin-2-yl]acetate::(2R)-2-[(Carbomethoxy)methyl]-N,4-dimethyl-N-(1-methyl-1H-indol-2-ylmethyl)-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepine-7-carboxamide::1,4-Benzodiazepine deriv. 2 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 5100 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8713 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8713&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539882 11109453 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14710 COC(=O)C[C@@H]1Nc2ccc(cc2CN(C)C1=O)C(=O)N(C)Cc1cc2ccccc2n1C |r| InChI=1S/C25H28N4O4/c1-27-14-18-11-17(9-10-20(18)26-21(25(27)32)13-23(30)33-4)24(31)28(2)15-19-12-16-7-5-6-8-22(16)29(19)3/h5-12,21,26H,13-15H2,1-4H3 SMHQHIYGXNMNCE-UHFFFAOYSA-N 8714 (2S)-2-[(Carbomethoxy)methyl]-N,4-dimethyl-N-(1-methyl-1H-indol-2-ylmethyl)-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepine-7-carboxamide::methyl 2-[(2S)-4-methyl-7-{methyl[(1-methyl-1H-indol-2-yl)methyl]carbamoyl}-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepin-2-yl]acetate::1,4-Benzodiazepine deriv. 3 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) >100000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8714 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8714&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539883 11109454 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14711 CN(Cc1cc2ccccc2n1C)C(=O)c1ccc2NCC(=O)N(C)Cc2c1 InChI=1S/C22H24N4O2/c1-24-13-17-10-16(8-9-19(17)23-12-21(24)27)22(28)25(2)14-18-11-15-6-4-5-7-20(15)26(18)3/h4-11,23H,12-14H2,1-3H3 WOHJDBQRHPBJCQ-UHFFFAOYSA-N 8715 N,4-Dimethyl-N-(1-methyl-1H-indol-2-ylmethyl)-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepine-7-carboxamide::N,4-dimethyl-N-[(1-methyl-1H-indol-2-yl)methyl]-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepine-7-carboxamide::1,4-Benzodiazepine deriv. 4 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 2500 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8715 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8715&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539884 11109455 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14712 CC(=O)N(C)Cc1cc(ccc1N)C(=O)N(C)Cc2cc3ccccc3n2C InChI=1S/C22H26N4O2/c1-15(27)24(2)13-18-11-17(9-10-20(18)23)22(28)25(3)14-19-12-16-7-5-6-8-21(16)26(19)4/h5-12H,13-14,23H2,1-4H3 AWTBJNJPBKTHEV-UHFFFAOYSA-N 8716 3-[(N-Acetyl-N-methylamino)methyl]-4-amino-N-methyl-N-(1-methyl-1H-indol-2-ylmethyl)benzamide::4-amino-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]-3-[(N-methylacetamido)methyl]benzamide::benzamide deriv. 5 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 4700 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8716 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8716&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search ZAM 447018 11109456 DB03534 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14713 CN(Cc1cc2ccccc2n1C)C(=O)c1cccc(CN(C)C(C)=O)c1 InChI=1S/C22H25N3O2/c1-16(26)23(2)14-17-8-7-10-19(12-17)22(27)24(3)15-20-13-18-9-5-6-11-21(18)25(20)4/h5-13H,14-15H2,1-4H3 RMNMNSNCWZYBEG-UHFFFAOYSA-N 8717 3-[(N-Acetyl-N-methylamino)methyl]-N-methyl-N-(1-methyl-1H-indol-2-ylmethyl)benzamide::N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]-3-[(N-methylacetamido)methyl]benzamide::benzamide deriv. 6 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 121000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8717 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8717&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539885 11109457 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14714 CN(Cc1cc2ccccc2n1C)C(=O)c1ccc(N)cc1 InChI=1S/C18H19N3O/c1-20(18(22)13-7-9-15(19)10-8-13)12-16-11-14-5-3-4-6-17(14)21(16)2/h3-11H,12,19H2,1-2H3 ZNIKKTWPMSNEAW-UHFFFAOYSA-N 8718 4-Amino-N-methyl-N-(1-methyl-1H-indol-2-ylmethyl)-benzamide::4-amino-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]benzamide::benzamide deriv. 7 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 2600 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8718 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8718&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539886 11109458 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14715 CN(Cc1cc2ccccc2n1C)C(=O)c1ccccc1 InChI=1S/C18H18N2O/c1-19(18(21)14-8-4-3-5-9-14)13-16-12-15-10-6-7-11-17(15)20(16)2/h3-12H,13H2,1-2H3 OSHHQNITRNVSKO-UHFFFAOYSA-N 8719 N-Methyl-N-(1-methyl-1H-indol-2-ylmethyl)benzamide::N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]benzamide::benzamide deriv. 8 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) >100000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8719 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8719&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539887 11109459 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14716 Cn1c2ccccc2cc1CN(C)C(=O)\C=C\c3ccc(nc3)N InChI=1S/C19H20N4O/c1-22(19(24)10-8-14-7-9-18(20)21-12-14)13-16-11-15-5-3-4-6-17(15)23(16)2/h3-12H,13H2,1-2H3,(H2,20,21) AKFPMLBVLWZSQX-UHFFFAOYSA-N 8720 (2E)-3-(6-aminopyridin-3-yl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]prop-2-enamide::aminopyridine 4::3-(6-Aminopyridin-3-yl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]acrylamide::aminopyridine deriv. 9 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 4200 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8720 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8720&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search AYM 5287720 11109460 DB01865 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14717 CN(Cc1cc2ccccc2n1C)C(=O)\C=C\c1cnc(N)nc1 InChI=1S/C18H19N5O/c1-22(17(24)8-7-13-10-20-18(19)21-11-13)12-15-9-14-5-3-4-6-16(14)23(15)2/h3-11H,12H2,1-2H3,(H2,19,20,21) VKFDLGMJTNQANO-UHFFFAOYSA-N 8721 (E)-3-(2-Aminopyrimidin-5-yl)-N-methyl-N-(1-methyl-1H-indol-2-ylmethyl)acrylamide::(2E)-3-(2-aminopyrimidin-5-yl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]prop-2-enamide::aminopyrimidine deriv. 10 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 4300 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8721 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8721&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539888 11109461 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14718 CN(Cc1cc2ccccc2n1C)C(=O)CCc1ccc(N)nc1 InChI=1S/C19H22N4O/c1-22(19(24)10-8-14-7-9-18(20)21-12-14)13-16-11-15-5-3-4-6-17(15)23(16)2/h3-7,9,11-12H,8,10,13H2,1-2H3,(H2,20,21) CAEFFYSYRJMIGG-UHFFFAOYSA-N 8722 3-(6-Aminopyridin-3-yl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]propionamide::3-(6-aminopyridin-3-yl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]propanamide::aminopyridine deriv. 11 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 97400 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8722 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8722&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 447019 11109462 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14719 CN(Cc1cc2ccccc2n1C)C(=O)c1ccc(N)nc1 InChI=1S/C17H18N4O/c1-20(17(22)13-7-8-16(18)19-10-13)11-14-9-12-5-3-4-6-15(12)21(14)2/h3-10H,11H2,1-2H3,(H2,18,19) WUAULDNTPAVINA-UHFFFAOYSA-N 8723 6-amino-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]pyridine-3-carboxamide::6-Amino-N-methyl-N-(1-methyl-1H-indol-2-yl)nicotinamide::aminopyridine deriv. 12 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 19200 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8723 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8723&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539889 11109463 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14720 CN(Cc1cc2ccccc2n1C)C(=O)\C=C\c1ccc(N)cc1 InChI=1S/C20H21N3O/c1-22(20(24)12-9-15-7-10-17(21)11-8-15)14-18-13-16-5-3-4-6-19(16)23(18)2/h3-13H,14,21H2,1-2H3 JGTLZJKIHHZHOX-UHFFFAOYSA-N 8724 (E)-3-(4-Aminophenyl)-N-methyl-N-(1-methyl-1H-indol-2-ylmethyl)acrylamide::(2E)-3-(4-aminophenyl)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]prop-2-enamide::acrylamide deriv. 13 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 9000 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8724 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8724&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539890 11109464 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432 14721 CN(Cc1cc2ccccc2n1C)C(=O)\C=C\c1cccnc1 InChI=1S/C19H19N3O/c1-21(19(23)10-9-15-6-5-11-20-13-15)14-17-12-16-7-3-4-8-18(16)22(17)2/h3-13H,14H2,1-2H3 LGENXSSEFBSKIU-UHFFFAOYSA-N 8725 (2E)-N-methyl-N-[(1-methyl-1H-indol-2-yl)methyl]-3-(pyridin-3-yl)prop-2-enamide::(E)-N-Methyl-N-(1-methyl-1H-indol-2-ylmethyl)-3-(pyridin-3-yl)acrylamide::aminopyridine deriv. 14 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) 15200 30.00 C Curated from the literature by BindingDB 10.1021/jm020050+ 10.7270/Q2J38QQR 12109908 aid1796219 Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF 7/18/2002 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8725 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1027&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8725&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539891 11109465 1 MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_HAEIN P44432