BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 13183 CCn1c(=O)sn(C)c1=O InChI=1S/C5H8N2O2S/c1-3-7-4(8)6(2)10-5(7)9/h3H2,1-2H3 GAXSFPVDRLQTCI-UHFFFAOYSA-N 7774 4-Ethyl-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 1 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 5000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7774 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7774&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539132 11108548 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13184 CCn1sc(=O)n(CC)c1=O InChI=1S/C6H10N2O2S/c1-3-7-5(9)8(4-2)11-6(7)10/h3-4H2,1-2H3 JKYRTUMHSXJDAP-UHFFFAOYSA-N 7775 2,4-Diethyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 2 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 25000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7775 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7775&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539133 11108549 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13185 CCCn1sc(=O)n(CC)c1=O InChI=1S/C7H12N2O2S/c1-3-5-9-6(10)8(4-2)7(11)12-9/h3-5H2,1-2H3 ZTIIWKVSVKBRFJ-UHFFFAOYSA-N 7776 4-Ethyl-2-propyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 3 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 10000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7776 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7776&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539134 11108550 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13186 CCn1c(=O)sn(C(C)C)c1=O InChI=1S/C7H12N2O2S/c1-4-8-6(10)9(5(2)3)12-7(8)11/h5H,4H2,1-3H3 DLGHVUQYPMHDTD-UHFFFAOYSA-N 7777 4-ethyl-2-(propan-2-yl)-1,2,4-thiadiazolidine-3,5-dione::4-Ethyl-2-isopropyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 4 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 35000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7777 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7777&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539135 11108551 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13187 CCn1c(=O)sn(C2CCCCC2)c1=O InChI=1S/C10H16N2O2S/c1-2-11-9(13)12(15-10(11)14)8-6-4-3-5-7-8/h8H,2-7H2,1H3 AWCNPQIUQNYGOA-UHFFFAOYSA-N 7778 2-Cyclohexyl-4-ethyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 5 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 10000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7778 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7778&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539136 11108552 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13188 CCCCn1c(=O)sn(CC)c1=O InChI=1S/C8H14N2O2S/c1-3-5-6-9-7(11)10(4-2)13-8(9)12/h3-6H2,1-2H3 WTFFYZGCISALRI-UHFFFAOYSA-N 7779 4-butyl-2-ethyl-1,2,4-thiadiazolidine-3,5-dione::4-n-Butyl-2-ethyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 6 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 70000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7779 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7779&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539137 11108553 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13189 Cn1sc(=O)n(C2CCCCC2)c1=O InChI=1S/C9H14N2O2S/c1-10-8(12)11(9(13)14-10)7-5-3-2-4-6-7/h7H,2-6H2,1H3 MIVSMYSKQZAUHL-UHFFFAOYSA-N 7780 4-Cyclohexyl-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 7 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus >100000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7780 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7780&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539138 11108554 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13190 CN1C(=O)N(C(=O)S1)Cc2ccccc2 InChI=1S/C10H10N2O2S/c1-11-9(13)12(10(14)15-11)7-8-5-3-2-4-6-8/h2-6H,7H2,1H3 JDSJDASOXWCHPN-UHFFFAOYSA-N 7781 4-Benzyl-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 8::TDZD-8::NP 01139::US20230414581, Compound 1 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 2000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7781 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7781&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search U3W 4124851 11108555 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13191 CCn1sc(=O)n(Cc2ccccc2)c1=O InChI=1S/C11H12N2O2S/c1-2-13-10(14)12(11(15)16-13)8-9-6-4-3-5-7-9/h3-7H,2,8H2,1H3 VNCNRIGKOMHMLM-UHFFFAOYSA-N 7782 CHEMBL26241::4-Benzyl-2-ethyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 9 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 7000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7782 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7782&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539139 11108556 CHEMBL26241 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13192 O=c1sn(Cc2ccccc2)c(=O)n1Cc1ccccc1 InChI=1S/C16H14N2O2S/c19-15-17(11-13-7-3-1-4-8-13)16(20)21-18(15)12-14-9-5-2-6-10-14/h1-10H,11-12H2 SGSVNPJHIDULGL-UHFFFAOYSA-N 7783 2,4-Dibenzyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 10 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 10000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7783 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7783&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539140 11108557 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13193 Cn1sc(=O)n(-c2ccccc2)c1=O InChI=1S/C9H8N2O2S/c1-10-8(12)11(9(13)14-10)7-5-3-2-4-6-7/h2-6H,1H3 LSXPXEJAKMFTTI-UHFFFAOYSA-N 7784 2-methyl-4-phenyl-1,2,4-thiadiazolidine-3,5-dione::4-Phenyl-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 11 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 2000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7784 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7784&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 2732733 11108558 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13194 Cn1sc(=O)n(-c2ccc(Br)cc2)c1=O InChI=1S/C9H7BrN2O2S/c1-11-8(13)12(9(14)15-11)7-4-2-6(10)3-5-7/h2-5H,1H3 ZQPFDLGDWZNXJY-UHFFFAOYSA-N 7785 4-(4-Bromophenyl)-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 12 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 3000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7785 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7785&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539141 11108559 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13195 Cn1sc(=O)n(-c2cccc(Br)c2)c1=O InChI=1S/C9H7BrN2O2S/c1-11-8(13)12(9(14)15-11)7-4-2-3-6(10)5-7/h2-5H,1H3 YMIUQWHOVJWHJW-UHFFFAOYSA-N 7786 4-(3-Bromophenyl)-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 13 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 4000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7786 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7786&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539142 11108560 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13196 Cn1sc(=O)n(-c2ccccc2Br)c1=O |(-2.2,-2.25,;-1.3,-1,;.25,-1,;.72,.46,;2.05,1.23,;-.52,1.37,;-.52,2.91,;-1.86,3.68,;-1.86,5.22,;-.52,5.99,;.81,5.22,;.81,3.68,;2.14,2.91,;-1.77,.46,;-3.24,.94,)| InChI=1S/C9H7BrN2O2S/c1-11-8(13)12(9(14)15-11)7-5-3-2-4-6(7)10/h2-5H,1H3 RWSHCVXAJREWPL-UHFFFAOYSA-N 7787 4-(2-Bromophenyl)-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 14 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 6000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7787 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7787&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539143 11108561 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13197 CN1C(=O)N(C(=O)S1)Cc2ccccc2 InChI=1S/C10H10N2O2S/c1-11-9(13)12(10(14)15-11)7-8-5-3-2-4-6-8/h2-6H,7H2,1H3 JDSJDASOXWCHPN-UHFFFAOYSA-N 7781 4-Benzyl-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 8::TDZD-8::NP 01139::US20230414581, Compound 1 Cyclin-dependent kinase/G2/mitotic-specific cyclin- 1 Homo sapiens >100000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796094 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7781 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=95&target=Cyclin-dependent+kinase%2FG2%2Fmitotic-specific+cyclin-+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7781&enzyme=Cyclin-dependent+kinase%2FG2%2Fmitotic-specific+cyclin-+1&column=ki&startPg=0&Increment=50&submit=Search U3W 7BMD 4124851 11108555 2 MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM 7NJ0,4YC6,6GU7,6GU6,6GU4,6GU3,6GU2,5LQF,5HQ0,4YC3,4Y72 Cyclin-dependent kinase 1 CDK1_HUMAN P06493 A8K7C4 C9J497 O60764 MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV 7NJ0,2JGZ,9FH9 G2/mitotic-specific cyclin-B1 CCNB1_HUMAN P14635 A8K066 Q5TZP9 13198 CN1C(=O)N(C(=O)S1)Cc2ccccc2 InChI=1S/C10H10N2O2S/c1-11-9(13)12(10(14)15-11)7-8-5-3-2-4-6-8/h2-6H,7H2,1H3 JDSJDASOXWCHPN-UHFFFAOYSA-N 7781 4-Benzyl-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 8::TDZD-8::NP 01139::US20230414581, Compound 1 Beta-casein Bos taurus >100000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796094 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7781 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=984&target=Beta-casein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7781&enzyme=Beta-casein&column=ki&startPg=0&Increment=50&submit=Search U3W 7BMD 4124851 11108555 1 MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV Beta-casein CASB_BOVIN P02666 A1YQZ8 A6N8V0 Q2TA13 Q5EEQ6 Q5EEQ7 Q6UN63 Q9BDG5 Q9TSD5 13199 CN1C(=O)N(C(=O)S1)Cc2ccccc2 InChI=1S/C10H10N2O2S/c1-11-9(13)12(10(14)15-11)7-8-5-3-2-4-6-8/h2-6H,7H2,1H3 JDSJDASOXWCHPN-UHFFFAOYSA-N 7781 4-Benzyl-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 8::TDZD-8::NP 01139::US20230414581, Compound 1 Protein kinase C beta type Rattus norvegicus >100000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796095 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7781 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=427&target=Protein+kinase+C+beta+type&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7781&enzyme=Protein+kinase+C+beta+type&column=ki&startPg=0&Increment=50&submit=Search U3W 7BMD 4124851 11108555 1 MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV Protein kinase C beta type KPCB_RAT P68403 P04410 P04411 13200 CN1C(=O)N(C(=O)S1)Cc2ccccc2 InChI=1S/C10H10N2O2S/c1-11-9(13)12(10(14)15-11)7-8-5-3-2-4-6-8/h2-6H,7H2,1H3 JDSJDASOXWCHPN-UHFFFAOYSA-N 7781 4-Benzyl-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 8::TDZD-8::NP 01139::US20230414581, Compound 1 cAMP-dependent protein kinase catalytic subunit alpha Bos taurus >100000 7.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796094 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7781 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=448&target=cAMP-dependent+protein+kinase+catalytic+subunit+alpha&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7781&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+alpha&column=ki&startPg=0&Increment=50&submit=Search U3W 7BMD 4124851 11108555 1 MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF 9FQR,9DW9,9DW8,9DW7,9DW5,9DW4,8SF8,6E9L,6E99,5VIB,5VI9,5VHB,4IE9,3ZO4,3ZO3,3ZO2,3ZO1,3AG9,2VO7,2OJF,2OH0,2JDS,2F7Z,2F7X,2F7E,2C1B,2C1A,4IJ9,3KKV,3E8E,3E8C,3BWJ,2GFC,1XH8,1XH7,1XH6,1XH5,1XH4,1VEB,1SVH,1SVG,1SVE,1STC,1Q8W,1Q8U,1Q8T,7E12,7E0Z,6SNN,6F14,5NW8,5N3N,3J4R,3J4Q,2ERZ,8X5L,7PNS,7PIH,7PIG,7PIF,7PIE,7PID,7BB0,7BAR,7BAQ,7AXW,7AXV,7AXT,6ZN0,6Z44,6Z08,6YQK,6YQJ,6YQI,6YPS,6YPP,6YOU,6YOT,6YNT,6YNR,6YNC,6YNB,6YNA,6Y8C,6Y89,6Y2U,6Y2O,6Y0B,6Y05,6SQ1,6SPY,6SPU,6SPS,6SPM,6SOX,6SNX,6I2H,6I2D,6I2C,6I2B,6I2A,6FRX,6ESA,6ERW,6ERV,6ERU,6ERT,6EMA,6EM7,6EM6,6EM2,6EH3,6EH2,6EH0,6EGW,5OUS,5OUC,5OUA,5OTG,5OT3,5OL3,5OK3,5O5M,5O0E,5NTJ,5N7U,5N7P,5N3T,5N3S,5N3R,5N3Q,5N3P,5N3O,5N3M,5N3L,5N3K,5N3J,5N3I,5N3H,5N3G,5N3F,5N3E,5N3D,5N3C,5N3B,5N3A,5N39,5N37,5N36,5N33,5N32,5N1O,5N1N,5N1M,5N1L,5N1K,5N1H,5N1G,5N1F,5N1E,5N1D,5MHI,5M75,5M71,5M6Y,5M6V,5M0U,5M0L,5M0C,5M0B,5LCU,5LCT,5LCR,5LCQ,5LCP,4WIH,3AMB,3AMA,3X2W,3X2V,3X2U,5X3F cAMP-dependent protein kinase catalytic subunit alpha KAPCA_BOVIN P00517 13201 Cn1sc(=O)n(-c2ccc(Cl)cc2)c1=O InChI=1S/C9H7ClN2O2S/c1-11-8(13)12(9(14)15-11)7-4-2-6(10)3-5-7/h2-5H,1H3 XPFLDDSMNQTKFF-UHFFFAOYSA-N 7788 4-(4-Chlorophenyl)-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 15 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 4000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7788 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7788&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539144 11108562 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13202 Cn1sc(=O)n(-c2ccc(F)cc2)c1=O InChI=1S/C9H7FN2O2S/c1-11-8(13)12(9(14)15-11)7-4-2-6(10)3-5-7/h2-5H,1H3 YSRWHCMGAXQJDJ-UHFFFAOYSA-N 7789 4-(4-Fluorophenyl)-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 16 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 4000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7789&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 3394376 11108563 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13203 Cn1sc(=O)n(-c2ccc(cc2)C(F)(F)F)c1=O InChI=1S/C10H7F3N2O2S/c1-14-8(16)15(9(17)18-14)7-4-2-6(3-5-7)10(11,12)13/h2-5H,1H3 CPHFCAJQZIPYIU-UHFFFAOYSA-N 7790 2-methyl-4-[4-(trifluoromethyl)phenyl]-1,2,4-thiadiazolidine-3,5-dione::2-Methyl-4-(4-trifluoromethylphenyl)-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 17 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 6000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7790 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7790&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539145 11108564 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13204 Cc1ccc(cc1)-n1c(=O)sn(C)c1=O InChI=1S/C10H10N2O2S/c1-7-3-5-8(6-4-7)12-9(13)11(2)15-10(12)14/h3-6H,1-2H3 UWPQPPHMFSIYFH-UHFFFAOYSA-N 7791 4-(4-Methylphenyl)-2-methyl-1,2,4-thiadiazolidine-3,5-dione::2-methyl-4-(4-methylphenyl)-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 18 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 5000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7791 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7791&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539146 11108565 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13205 COc1ccc(cc1)-n1c(=O)sn(C)c1=O InChI=1S/C10H10N2O3S/c1-11-9(13)12(10(14)16-11)7-3-5-8(15-2)6-4-7/h3-6H,1-2H3 PDTUDJWWGQIQSW-UHFFFAOYSA-N 7792 4-(4-Methoxylphenyl)-2-methyl-1,2,4-thiadiazolidine-3,5-dione::4-(4-methoxyphenyl)-2-methyl-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 19 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 2000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7792 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7792&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539147 11108566 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13206 Cn1sc(=O)n(-c2cccc3ccccc23)c1=O |(-2.2,-2.25,;-1.3,-1,;.25,-1,;.72,.46,;2.05,1.23,;-.52,1.37,;-.52,2.91,;-1.86,3.68,;-1.86,5.22,;-.52,5.99,;.75,5.22,;2.08,5.99,;3.42,5.22,;3.42,3.68,;2.08,2.91,;.75,3.68,;-1.77,.46,;-3.24,.94,)| InChI=1S/C13H10N2O2S/c1-14-12(16)15(13(17)18-14)11-8-4-6-9-5-2-3-7-10(9)11/h2-8H,1H3 XITIQXYTIHHGHR-UHFFFAOYSA-N 7793 2-methyl-4-(1-naphthyl)-1,2,4-thiadiazolidine-3,5-dione::2-methyl-4-(naphthalen-1-yl)-1,2,4-thiadiazolidine-3,5-dione::Thiadiazolidinone (TDZD) deriv. 20 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 3000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7793 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7793&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539148 11108567 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13207 CCn1sc(=O)n(CC)c1=S InChI=1S/C6H10N2OS2/c1-3-7-5(10)8(4-2)11-6(7)9/h3-4H2,1-2H3 LDHHNMNHSWWSNP-UHFFFAOYSA-N 7794 2,4-diethyl-3-thioxo-1,2,4-thiadiazolidin-5-one::2,4-diethyl-3-sulfanylidene-1,2,4-thiadiazolidin-5-one::Thiadiazolidinone (TDZD) deriv. 21 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 20000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7794 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7794&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539149 11108568 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13208 O=c1sn(-c2ccccc2)c(=S)n1-c1ccccc1 InChI=1S/C14H10N2OS2/c17-14-15(11-7-3-1-4-8-11)13(18)16(19-14)12-9-5-2-6-10-12/h1-10H PRDNKKPIALEDSB-UHFFFAOYSA-N 7795 2,4-diphenyl-5-oxo-1,2,4-thiadiazolidine-3-thione::2,4-diphenyl-3-sulfanylidene-1,2,4-thiadiazolidin-5-one::Thiadiazolidinone (TDZD) deriv. 22 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 8000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7795 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7795&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539150 11108569 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13209 O=c1sn(Cc2ccccc2)c(=S)n1Cc1ccccc1 InChI=1S/C16H14N2OS2/c19-16-17(11-13-7-3-1-4-8-13)15(20)18(21-16)12-14-9-5-2-6-10-14/h1-10H,11-12H2 RUJZRLFQRAMGNM-UHFFFAOYSA-N 7796 2,4-Dibenzyl-5-oxo-1,2,4-thiadiazolidine-3-thione::2,4-dibenzyl-3-sulfanylidene-1,2,4-thiadiazolidin-5-one::Thiadiazolidinone (TDZD) deriv. 23 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 10000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7796 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7796&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 4677904 11108570 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13210 CCn1sc(=O)n(Cc2ccccc2)c1=S InChI=1S/C11H12N2OS2/c1-2-13-10(15)12(11(14)16-13)8-9-6-4-3-5-7-9/h3-7H,2,8H2,1H3 UJAAUYOYAOCFDA-UHFFFAOYSA-N 7797 4-Benzyl-2-ethyl-5-oxo-1,2,4-thiadiazolidine-3-thione::4-benzyl-2-ethyl-3-sulfanylidene-1,2,4-thiadiazolidin-5-one::Thiadiazolidinone (TDZD) deriv. 24 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 6000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7797 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7797&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539151 11108571 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13211 CCn1c(=S)n(C)s\c1=N/c1cccnc1 InChI=1S/C10H12N4S2/c1-3-14-9(16-13(2)10(14)15)12-8-5-4-6-11-7-8/h4-7H,3H2,1-2H3 SKLFEJQSUNHSGH-UHFFFAOYSA-N 7798 (5Z)-4-ethyl-2-methyl-5-(pyridin-3-ylimino)-1,2,4-thiadiazolidine-3-thione::Thiadiazolidinone (TDZD) deriv. 25 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 10000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7798 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7798&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539152 11108572 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13212 CCNC(=O)\N=c1/sn(CC)c(=O)n1-c1ccccc1 InChI=1S/C13H16N4O2S/c1-3-14-11(18)15-12-17(10-8-6-5-7-9-10)13(19)16(4-2)20-12/h5-9H,3-4H2,1-2H3,(H,14,18) XKPDTDAOVRTTRA-UHFFFAOYSA-N 7799 ethyl-(2-ethyl-3-oxo-4-phenyl-1,2,4-thiadiazolidin-5-ylidene)urea::3-ethyl-1-[(5Z)-2-ethyl-3-oxo-4-phenyl-1,2,4-thiadiazolidin-5-ylidene]urea::Thiadiazolidinone (TDZD) deriv. 26 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 75000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7799 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7799&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 9604909 11108573 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13213 CCn1sc(=N)n(-c2ccccc2)c1=O InChI=1S/C10H11N3OS/c1-2-12-10(14)13(9(11)15-12)8-6-4-3-5-7-8/h3-7,11H,2H2,1H3 DXUKWQAPCPMKRC-UHFFFAOYSA-N 7800 2-Ethyl-3-oxo-4-phenyl-1,2,4-thiadiazolidin-5-imine::2-ethyl-5-imino-4-phenyl-1,2,4-thiadiazolidin-3-one::Thiadiazolidinone (TDZD) deriv. 27 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 65000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7800 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7800&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 6539154 11108574 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2 13214 CCOC(=O)\N=c1/sn(C(=O)OCC)c(=S)n1-c1ccccc1 InChI=1S/C14H15N3O4S2/c1-3-20-12(18)15-11-16(10-8-6-5-7-9-10)13(22)17(23-11)14(19)21-4-2/h5-9H,3-4H2,1-2H3 CJCKCRCDANXHKS-UHFFFAOYSA-N 7801 ethyl (5Z)-5-[(ethoxycarbonyl)imino]-4-phenyl-3-sulfanylidene-1,2,4-thiadiazolidine-2-carboxylate::Thiadiazolidinone (TDZD) deriv. 28 Glycogen synthase kinase-3 beta [7-25] Oryctolagus cuniculus 100000 37.00 C Curated from the literature by BindingDB 10.1021/jm011020u 10.7270/Q2P26WB1 11881998 aid1796093 Martinez, A; Alonso, M; Castro, A; Perez, C; Moreno, FJ 3/14/2002 2/26/2006 Instituto De Quimica Medica (Csic) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7801 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=862&target=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7801&enzyme=Glycogen+synthase+kinase-3+beta+%5B7-25%5D&column=ki&startPg=0&Increment=50&submit=Search 9604910 11108575 1 TTSFAESCKPVQQPSAFGS Glycogen synthase kinase-3 beta G1T8E2_RABIT G1T8E2