BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50200196 Cc1ccc2CCCC(Cc2c1)NCC1CN(CCNS(=O)(=O)c2cccc3ccccc23)C1 InChI=1S/C28H35N3O2S/c1-21-12-13-23-7-4-9-26(17-25(23)16-21)29-18-22-19-31(20-22)15-14-30-34(32,33)28-11-5-8-24-6-2-3-10-27(24)28/h2-3,5-6,8,10-13,16,22,26,29-30H,4,7,9,14-15,17-20H2,1H3 AMQSYOMODAGIDR-UHFFFAOYSA-N 50110404 Naphthalene-1-sulfonic acid (2-{3-[(3-methyl-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-azetidin-1-yl}-ethyl)-amide::CHEMBL350379 Neuropeptide Y receptor type 5 Homo sapiens 190 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110404 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110404&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377476 104005187 CHEMBL350379 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200197 COc1ccc2CCCC(Cc2c1OC)NCC1CN(CCNS(=O)(=O)c2cccc3ccccc23)C1 InChI=1S/C29H37N3O4S/c1-35-27-14-13-23-8-5-10-24(17-26(23)29(27)36-2)30-18-21-19-32(20-21)16-15-31-37(33,34)28-12-6-9-22-7-3-4-11-25(22)28/h3-4,6-7,9,11-14,21,24,30-31H,5,8,10,15-20H2,1-2H3 KWTSCJCXCQYOFR-UHFFFAOYSA-N 50110405 Naphthalene-1-sulfonic acid (2-{3-[(3,4-dimethoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-azetidin-1-yl}-ethyl)-amide::CHEMBL164748 Neuropeptide Y receptor type 5 Homo sapiens 140 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110405 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110405&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377916 104005188 CHEMBL164748 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200198 COc1ccc2CCCC(CNCCN3CCC(CNS(=O)(=O)c4cccc5ccccc45)CC3)Cc2c1 InChI=1S/C31H41N3O3S/c1-37-29-13-12-26-8-4-6-25(20-28(26)21-29)22-32-16-19-34-17-14-24(15-18-34)23-33-38(35,36)31-11-5-9-27-7-2-3-10-30(27)31/h2-3,5,7,9-13,21,24-25,32-33H,4,6,8,14-20,22-23H2,1H3 OSROTSUOLDJSCS-UHFFFAOYSA-N 50110406 Naphthalene-1-sulfonic acid (1-{2-[(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylmethyl)-amino]-ethyl}-piperidin-4-ylmethyl)-amide::CHEMBL164971 Neuropeptide Y receptor type 5 Homo sapiens 540 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110406 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110406&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377722 104005189 CHEMBL164971 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200199 COc1ccc2CCCC(Cc2c1)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C30H39N3O3S/c1-36-28-13-12-24-7-4-9-27(20-26(24)21-28)31-22-23-14-17-33(18-15-23)19-16-32-37(34,35)30-11-5-8-25-6-2-3-10-29(25)30/h2-3,5-6,8,10-13,21,23,27,31-32H,4,7,9,14-20,22H2,1H3 QEMYWIPVNFBRSI-UHFFFAOYSA-N 50110407 Naphthalene-1-sulfonic acid (2-{4-[(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL162093 Neuropeptide Y receptor type 1 Homo sapiens 14000 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110407 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110407&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 44377450 104005190 CHEMBL162093 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200200 COc1ccc2CCCC(Cc2c1)NC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C29H37N3O3S/c1-35-27-13-12-22-7-4-9-26(20-24(22)21-27)31-25-14-17-32(18-15-25)19-16-30-36(33,34)29-11-5-8-23-6-2-3-10-28(23)29/h2-3,5-6,8,10-13,21,25-26,30-31H,4,7,9,14-20H2,1H3 BRQNJSZAEBIZIO-UHFFFAOYSA-N 50110408 Naphthalene-1-sulfonic acid {2-[4-(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-piperidin-1-yl]-ethyl}-amide::CHEMBL165506 Neuropeptide Y receptor type 1 Homo sapiens 35000 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110408 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110408&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 44377731 104005191 CHEMBL165506 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200201 O=S(=O)(NCCN1CCC(CNC2CCCc3ccccc3C2)CC1)c1cccc2ccccc12 InChI=1S/C29H37N3O2S/c33-35(34,29-14-6-11-25-8-3-4-13-28(25)29)31-17-20-32-18-15-23(16-19-32)22-30-27-12-5-10-24-7-1-2-9-26(24)21-27/h1-4,6-9,11,13-14,23,27,30-31H,5,10,12,15-22H2 KHBMCOXJYSUWKL-UHFFFAOYSA-N 50110409 Naphthalene-1-sulfonic acid (2-{4-[(6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL348806 Neuropeptide Y receptor type 5 Homo sapiens 210 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110409 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110409&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377734 104005192 CHEMBL348806 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200202 Cc1ccc2CCCC(Cc2c1)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C30H39N3O2S/c1-23-12-13-25-7-4-9-28(21-27(25)20-23)31-22-24-14-17-33(18-15-24)19-16-32-36(34,35)30-11-5-8-26-6-2-3-10-29(26)30/h2-3,5-6,8,10-13,20,24,28,31-32H,4,7,9,14-19,21-22H2,1H3 FYSXLFCIJKLFFD-UHFFFAOYSA-N 50110410 Naphthalene-1-sulfonic acid (2-{4-[(3-methyl-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL162094 Neuropeptide Y receptor type 1 Homo sapiens 18000 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110410 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110410&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 44377461 104005193 CHEMBL162094 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200203 Clc1ccc2CCCC(Cc2c1)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C29H36ClN3O2S/c30-26-12-11-23-6-3-8-27(20-25(23)19-26)31-21-22-13-16-33(17-14-22)18-15-32-36(34,35)29-10-4-7-24-5-1-2-9-28(24)29/h1-2,4-5,7,9-12,19,22,27,31-32H,3,6,8,13-18,20-21H2 PPVPMIUFXSUMPV-UHFFFAOYSA-N 50110411 Naphthalene-1-sulfonic acid (2-{4-[(3-chloro-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL163470 Neuropeptide Y receptor type 5 Homo sapiens 85.0 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110411 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110411&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377468 104005194 CHEMBL163470 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200204 [O-][N+](=O)c1ccc2CCCC(Cc2c1)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C29H36N4O4S/c34-33(35)27-12-11-23-6-3-8-26(19-25(23)20-27)30-21-22-13-16-32(17-14-22)18-15-31-38(36,37)29-10-4-7-24-5-1-2-9-28(24)29/h1-2,4-5,7,9-12,20,22,26,30-31H,3,6,8,13-19,21H2 MQXWKDIFOXIPIR-UHFFFAOYSA-N 50110412 Naphthalene-1-sulfonic acid (2-{4-[(3-nitro-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL159450 Neuropeptide Y receptor type 5 Homo sapiens 79.0 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110412 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110412&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377460 104005195 CHEMBL159450 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200205 COc1ccc2CCCC(CNCC3CN(CCNS(=O)(=O)c4cccc5ccccc45)C3)Cc2c1 InChI=1S/C29H37N3O3S/c1-35-27-13-12-24-8-4-6-22(16-26(24)17-27)18-30-19-23-20-32(21-23)15-14-31-36(33,34)29-11-5-9-25-7-2-3-10-28(25)29/h2-3,5,7,9-13,17,22-23,30-31H,4,6,8,14-16,18-21H2,1H3 JDKBURQCHYJSJP-UHFFFAOYSA-N 50110413 Naphthalene-1-sulfonic acid [2-(3-{[(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylmethyl)-amino]-methyl}-azetidin-1-yl)-ethyl]-amide::CHEMBL351082 Neuropeptide Y receptor type 1 Homo sapiens 22000 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110413 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110413&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 44377854 104005196 CHEMBL351082 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200206 COc1ccc2CCCC(Cc2c1)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C30H39N3O3S/c1-36-28-13-12-24-7-4-9-27(20-26(24)21-28)31-22-23-14-17-33(18-15-23)19-16-32-37(34,35)30-11-5-8-25-6-2-3-10-29(25)30/h2-3,5-6,8,10-13,21,23,27,31-32H,4,7,9,14-20,22H2,1H3 QEMYWIPVNFBRSI-UHFFFAOYSA-N 50110407 Naphthalene-1-sulfonic acid (2-{4-[(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL162093 Neuropeptide Y receptor type 5 Homo sapiens 45.0 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110407 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110407&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377450 104005190 CHEMBL162093 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200207 O=S(=O)(NC[C@@H]1CC[C@H](CNCC2CCc3ccccc3C2)CC1)c1cccc2ccccc12 |wU:5.4,8.8,(20.02,-8.52,;20.02,-6.98,;20.02,-5.43,;18.69,-6.2,;17.36,-6.99,;16.03,-6.22,;15.25,-4.89,;13.73,-4.87,;12.96,-6.2,;11.63,-5.43,;10.29,-6.2,;8.96,-5.43,;7.61,-6.2,;7.61,-7.75,;6.27,-8.52,;4.93,-7.72,;3.6,-8.52,;2.27,-7.75,;2.27,-6.2,;3.6,-5.43,;4.94,-6.2,;6.27,-5.41,;13.73,-7.54,;15.25,-7.54,;21.37,-6.2,;22.13,-7.54,;23.65,-7.54,;24.42,-6.23,;23.65,-4.9,;24.42,-3.58,;23.65,-2.25,;22.13,-2.27,;21.37,-3.59,;22.13,-4.9,)| InChI=1S/C29H36N2O2S/c32-34(33,29-11-5-9-26-7-3-4-10-28(26)29)31-21-23-14-12-22(13-15-23)19-30-20-24-16-17-25-6-1-2-8-27(25)18-24/h1-11,22-24,30-31H,12-21H2 IYJDQLQMYQTJHS-UHFFFAOYSA-N 50110415 Naphthalene-1-sulfonic acid (4-{[(1,2,3,4-tetrahydro-naphthalen-2-ylmethyl)-amino]-methyl}-cyclohexylmethyl)-amide::CHEMBL164897 Neuropeptide Y receptor type 5 Homo sapiens 38 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110415 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110415&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 21336511 104005198 CHEMBL164897 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200208 COc1ccc2CCCC(CNCCN3CCC(CNS(=O)(=O)c4cccc5ccccc45)CC3)Cc2c1 InChI=1S/C31H41N3O3S/c1-37-29-13-12-26-8-4-6-25(20-28(26)21-29)22-32-16-19-34-17-14-24(15-18-34)23-33-38(35,36)31-11-5-9-27-7-2-3-10-30(27)31/h2-3,5,7,9-13,21,24-25,32-33H,4,6,8,14-20,22-23H2,1H3 OSROTSUOLDJSCS-UHFFFAOYSA-N 50110406 Naphthalene-1-sulfonic acid (1-{2-[(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylmethyl)-amino]-ethyl}-piperidin-4-ylmethyl)-amide::CHEMBL164971 Neuropeptide Y receptor type 1 Homo sapiens 2800.0 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110406 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110406&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 44377722 104005189 CHEMBL164971 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200209 Nc1ccc2CCCC(Cc2c1)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C29H38N4O2S/c30-26-12-11-23-6-3-8-27(20-25(23)19-26)31-21-22-13-16-33(17-14-22)18-15-32-36(34,35)29-10-4-7-24-5-1-2-9-28(24)29/h1-2,4-5,7,9-12,19,22,27,31-32H,3,6,8,13-18,20-21,30H2 BBZYLZUPRQGZEQ-UHFFFAOYSA-N 50110414 Naphthalene-1-sulfonic acid (2-{4-[(3-amino-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL164586 Neuropeptide Y receptor type 5 Homo sapiens 52 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110414 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110414&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377691 104005197 CHEMBL164586 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200210 [O-][N+](=O)c1ccc2CCCC(Cc2c1)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C29H36N4O4S/c34-33(35)27-12-11-23-6-3-8-26(19-25(23)20-27)30-21-22-13-16-32(17-14-22)18-15-31-38(36,37)29-10-4-7-24-5-1-2-9-28(24)29/h1-2,4-5,7,9-12,20,22,26,30-31H,3,6,8,13-19,21H2 MQXWKDIFOXIPIR-UHFFFAOYSA-N 50110412 Naphthalene-1-sulfonic acid (2-{4-[(3-nitro-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL159450 Neuropeptide Y receptor type 1 Homo sapiens 15000 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110412 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110412&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 44377460 104005195 CHEMBL159450 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200211 COc1ccc2CCCC(CNC3CCN(CCNS(=O)(=O)c4cccc5ccccc45)CC3)Cc2c1 InChI=1S/C30H39N3O3S/c1-36-28-13-12-24-8-4-6-23(20-26(24)21-28)22-31-27-14-17-33(18-15-27)19-16-32-37(34,35)30-11-5-9-25-7-2-3-10-29(25)30/h2-3,5,7,9-13,21,23,27,31-32H,4,6,8,14-20,22H2,1H3 DEJOSPKGOMVPEP-UHFFFAOYSA-N 50110417 Naphthalene-1-sulfonic acid (2-{4-[(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylmethyl)-amino]-piperidin-1-yl}-ethyl)-amide::CHEMBL351508 Neuropeptide Y receptor type 1 Homo sapiens 29000 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110417 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110417&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 44377452 104005200 CHEMBL351508 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200212 COc1ccc2CCCC(CNCC3CCN(CCNS(=O)(=O)c4cccc5ccccc45)CC3)Cc2c1 InChI=1S/C31H41N3O3S/c1-37-29-13-12-26-8-4-6-25(20-28(26)21-29)23-32-22-24-14-17-34(18-15-24)19-16-33-38(35,36)31-11-5-9-27-7-2-3-10-30(27)31/h2-3,5,7,9-13,21,24-25,32-33H,4,6,8,14-20,22-23H2,1H3 ITJLZSOZZWEOJL-UHFFFAOYSA-N 50110416 Naphthalene-1-sulfonic acid [2-(4-{[(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylmethyl)-amino]-methyl}-piperidin-1-yl)-ethyl]-amide::FR-226928::CHEMBL350620 Neuropeptide Y receptor type 5 Homo sapiens 16 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110416 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110416&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 10007341 104005199 CHEMBL350620 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200213 COc1ccc2CCCC(CNCC3CN(CCNS(=O)(=O)c4cccc5ccccc45)C3)Cc2c1 InChI=1S/C29H37N3O3S/c1-35-27-13-12-24-8-4-6-22(16-26(24)17-27)18-30-19-23-20-32(21-23)15-14-31-36(33,34)29-11-5-9-25-7-2-3-10-28(25)29/h2-3,5,7,9-13,17,22-23,30-31H,4,6,8,14-16,18-21H2,1H3 JDKBURQCHYJSJP-UHFFFAOYSA-N 50110413 Naphthalene-1-sulfonic acid [2-(3-{[(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylmethyl)-amino]-methyl}-azetidin-1-yl)-ethyl]-amide::CHEMBL351082 Neuropeptide Y receptor type 5 Homo sapiens 86 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110413 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110413&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377854 104005196 CHEMBL351082 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200214 Cc1ccc2CCCC(Cc2c1)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C30H39N3O2S/c1-23-12-13-25-7-4-9-28(21-27(25)20-23)31-22-24-14-17-33(18-15-24)19-16-32-36(34,35)30-11-5-8-26-6-2-3-10-29(26)30/h2-3,5-6,8,10-13,20,24,28,31-32H,4,7,9,14-19,21-22H2,1H3 FYSXLFCIJKLFFD-UHFFFAOYSA-N 50110410 Naphthalene-1-sulfonic acid (2-{4-[(3-methyl-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL162094 Neuropeptide Y receptor type 5 Homo sapiens 72.0 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110410 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110410&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377461 104005193 CHEMBL162094 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200215 COc1ccc2CCCC(CNC3CCN(CCNS(=O)(=O)c4cccc5ccccc45)CC3)Cc2c1 InChI=1S/C30H39N3O3S/c1-36-28-13-12-24-8-4-6-23(20-26(24)21-28)22-31-27-14-17-33(18-15-27)19-16-32-37(34,35)30-11-5-9-25-7-2-3-10-29(25)30/h2-3,5,7,9-13,21,23,27,31-32H,4,6,8,14-20,22H2,1H3 DEJOSPKGOMVPEP-UHFFFAOYSA-N 50110417 Naphthalene-1-sulfonic acid (2-{4-[(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylmethyl)-amino]-piperidin-1-yl}-ethyl)-amide::CHEMBL351508 Neuropeptide Y receptor type 5 Homo sapiens 39 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110417 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110417&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377452 104005200 CHEMBL351508 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200216 CCOC(=O)COc1ccc2CCCC(Cc2c1)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C33H43N3O5S/c1-2-40-33(37)24-41-30-14-13-26-8-5-10-29(21-28(26)22-30)34-23-25-15-18-36(19-16-25)20-17-35-42(38,39)32-12-6-9-27-7-3-4-11-31(27)32/h3-4,6-7,9,11-14,22,25,29,34-35H,2,5,8,10,15-21,23-24H2,1H3 OPAXHYJUSCNJMJ-UHFFFAOYSA-N 50110420 [8-({1-[2-(Naphthalene-1-sulfonylamino)-ethyl]-piperidin-4-ylmethyl}-amino)-6,7,8,9-tetrahydro-5H-benzocyclohepten-2-yloxy]-acetic acid ethyl ester::CHEMBL349386 Neuropeptide Y receptor type 5 Homo sapiens 680.0 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110420 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110420&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377661 104005203 CHEMBL349386 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200217 COc1ccc2CCCC(Cc2c1)NCCN1CCC(CNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C30H39N3O3S/c1-36-28-13-12-24-7-4-9-27(20-26(24)21-28)31-16-19-33-17-14-23(15-18-33)22-32-37(34,35)30-11-5-8-25-6-2-3-10-29(25)30/h2-3,5-6,8,10-13,21,23,27,31-32H,4,7,9,14-20,22H2,1H3 NYWWJUHGBUNGMO-UHFFFAOYSA-N 50110419 Naphthalene-1-sulfonic acid {1-[2-(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-ethyl]-piperidin-4-ylmethyl}-amide::CHEMBL167318 Neuropeptide Y receptor type 1 Homo sapiens 19000 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110419 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110419&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 44377689 104005202 CHEMBL167318 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200218 COc1ccc2CC(CCCc2c1)NCCN1CCC(CNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C30H39N3O3S/c1-36-28-13-12-26-20-27(9-4-8-25(26)21-28)31-16-19-33-17-14-23(15-18-33)22-32-37(34,35)30-11-5-7-24-6-2-3-10-29(24)30/h2-3,5-7,10-13,21,23,27,31-32H,4,8-9,14-20,22H2,1H3 IQJPHYKRXSTVIK-UHFFFAOYSA-N 50110418 Naphthalene-1-sulfonic acid {1-[2-(2-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-ethyl]-piperidin-4-ylmethyl}-amide::CHEMBL167926 Neuropeptide Y receptor type 5 Homo sapiens 1000 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110418 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110418&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377690 104005201 CHEMBL167926 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200219 COc1ccc2CCCC(Cc2c1)NCCN1CCC(CNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C30H39N3O3S/c1-36-28-13-12-24-7-4-9-27(20-26(24)21-28)31-16-19-33-17-14-23(15-18-33)22-32-37(34,35)30-11-5-8-25-6-2-3-10-29(25)30/h2-3,5-6,8,10-13,21,23,27,31-32H,4,7,9,14-20,22H2,1H3 NYWWJUHGBUNGMO-UHFFFAOYSA-N 50110419 Naphthalene-1-sulfonic acid {1-[2-(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-ethyl]-piperidin-4-ylmethyl}-amide::CHEMBL167318 Neuropeptide Y receptor type 5 Homo sapiens 740.0 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110419 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110419&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377689 104005202 CHEMBL167318 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200220 Clc1ccc2CCCC(Cc2c1)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C29H36ClN3O2S/c30-26-12-11-23-6-3-8-27(20-25(23)19-26)31-21-22-13-16-33(17-14-22)18-15-32-36(34,35)29-10-4-7-24-5-1-2-9-28(24)29/h1-2,4-5,7,9-12,19,22,27,31-32H,3,6,8,13-18,20-21H2 PPVPMIUFXSUMPV-UHFFFAOYSA-N 50110411 Naphthalene-1-sulfonic acid (2-{4-[(3-chloro-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL163470 Neuropeptide Y receptor type 1 Homo sapiens 8500.0 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110411 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110411&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 44377468 104005194 CHEMBL163470 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200221 COc1cc2CCCC(Cc2cc1OC)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C31H41N3O4S/c1-37-29-20-25-9-5-10-27(19-26(25)21-30(29)38-2)32-22-23-13-16-34(17-14-23)18-15-33-39(35,36)31-12-6-8-24-7-3-4-11-28(24)31/h3-4,6-8,11-12,20-21,23,27,32-33H,5,9-10,13-19,22H2,1-2H3 JQVWVHVZZVCIDS-UHFFFAOYSA-N 50110421 Naphthalene-1-sulfonic acid (2-{4-[(2,3-dimethoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL165556 Neuropeptide Y receptor type 5 Homo sapiens 68.0 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110421 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110421&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377440 104005204 CHEMBL165556 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200222 Clc1ccc2CCCC(Cc2c1)NCC1CN(CCNS(=O)(=O)c2cccc3ccccc23)C1 InChI=1S/C27H32ClN3O2S/c28-24-12-11-21-6-3-8-25(16-23(21)15-24)29-17-20-18-31(19-20)14-13-30-34(32,33)27-10-4-7-22-5-1-2-9-26(22)27/h1-2,4-5,7,9-12,15,20,25,29-30H,3,6,8,13-14,16-19H2 JIEXAWQYFXKUHL-UHFFFAOYSA-N 50110422 Naphthalene-1-sulfonic acid (2-{3-[(3-chloro-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-azetidin-1-yl}-ethyl)-amide::CHEMBL164805 Neuropeptide Y receptor type 5 Homo sapiens 310 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110422 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110422&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377915 104005205 CHEMBL164805 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200223 COc1ccc2CCCC(Cc2c1)NC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C29H37N3O3S/c1-35-27-13-12-22-7-4-9-26(20-24(22)21-27)31-25-14-17-32(18-15-25)19-16-30-36(33,34)29-11-5-8-23-6-2-3-10-28(23)29/h2-3,5-6,8,10-13,21,25-26,30-31H,4,7,9,14-20H2,1H3 BRQNJSZAEBIZIO-UHFFFAOYSA-N 50110408 Naphthalene-1-sulfonic acid {2-[4-(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-piperidin-1-yl]-ethyl}-amide::CHEMBL165506 Neuropeptide Y receptor type 5 Homo sapiens 66 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110408 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110408&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377731 104005191 CHEMBL165506 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200224 O=S(=O)(NC[C@@H]1CC[C@H](CNCC2CCc3ccccc3C2)CC1)c1cccc2ccccc12 |wU:5.4,8.8,(20.02,-8.52,;20.02,-6.98,;20.02,-5.43,;18.69,-6.2,;17.36,-6.99,;16.03,-6.22,;15.25,-4.89,;13.73,-4.87,;12.96,-6.2,;11.63,-5.43,;10.29,-6.2,;8.96,-5.43,;7.61,-6.2,;7.61,-7.75,;6.27,-8.52,;4.93,-7.72,;3.6,-8.52,;2.27,-7.75,;2.27,-6.2,;3.6,-5.43,;4.94,-6.2,;6.27,-5.41,;13.73,-7.54,;15.25,-7.54,;21.37,-6.2,;22.13,-7.54,;23.65,-7.54,;24.42,-6.23,;23.65,-4.9,;24.42,-3.58,;23.65,-2.25,;22.13,-2.27,;21.37,-3.59,;22.13,-4.9,)| InChI=1S/C29H36N2O2S/c32-34(33,29-11-5-9-26-7-3-4-10-28(26)29)31-21-23-14-12-22(13-15-23)19-30-20-24-16-17-25-6-1-2-8-27(25)18-24/h1-11,22-24,30-31H,12-21H2 IYJDQLQMYQTJHS-UHFFFAOYSA-N 50110415 Naphthalene-1-sulfonic acid (4-{[(1,2,3,4-tetrahydro-naphthalen-2-ylmethyl)-amino]-methyl}-cyclohexylmethyl)-amide::CHEMBL164897 Neuropeptide Y receptor type 1 Homo sapiens 1300 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110415 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110415&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 21336511 104005198 CHEMBL164897 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200225 COc1cc2CCCC(Cc2cc1OC)NCC1CCN(CCNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C31H41N3O4S/c1-37-29-20-25-9-5-10-27(19-26(25)21-30(29)38-2)32-22-23-13-16-34(17-14-23)18-15-33-39(35,36)31-12-6-8-24-7-3-4-11-28(24)31/h3-4,6-8,11-12,20-21,23,27,32-33H,5,9-10,13-19,22H2,1-2H3 JQVWVHVZZVCIDS-UHFFFAOYSA-N 50110421 Naphthalene-1-sulfonic acid (2-{4-[(2,3-dimethoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-methyl]-piperidin-1-yl}-ethyl)-amide::CHEMBL165556 Neuropeptide Y receptor type 1 Homo sapiens 17000 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110421 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110421&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 44377440 104005204 CHEMBL165556 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50200226 COc1cccc2CC(CCCc12)NCCN1CCC(CNS(=O)(=O)c2cccc3ccccc23)CC1 InChI=1S/C30H39N3O3S/c1-36-29-13-4-9-25-21-26(10-6-12-27(25)29)31-17-20-33-18-15-23(16-19-33)22-32-37(34,35)30-14-5-8-24-7-2-3-11-28(24)30/h2-5,7-9,11,13-14,23,26,31-32H,6,10,12,15-22H2,1H3 KPOBPQKQEHWPFI-UHFFFAOYSA-N 50110423 Naphthalene-1-sulfonic acid {1-[2-(1-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylamino)-ethyl]-piperidin-4-ylmethyl}-amide::CHEMBL166315 Neuropeptide Y receptor type 5 Homo sapiens >1000 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110423 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110423&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 44377681 104005206 CHEMBL166315 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50200227 COc1ccc2CCCC(CNCC3CCN(CCNS(=O)(=O)c4cccc5ccccc45)CC3)Cc2c1 InChI=1S/C31H41N3O3S/c1-37-29-13-12-26-8-4-6-25(20-28(26)21-29)23-32-22-24-14-17-34(18-15-24)19-16-33-38(35,36)31-11-5-9-27-7-2-3-10-30(27)31/h2-3,5,7,9-13,21,24-25,32-33H,4,6,8,14-20,22-23H2,1H3 ITJLZSOZZWEOJL-UHFFFAOYSA-N 50110416 Naphthalene-1-sulfonic acid [2-(4-{[(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-6-ylmethyl)-amino]-methyl}-piperidin-1-yl)-ethyl]-amide::FR-226928::CHEMBL350620 Neuropeptide Y receptor type 1 Homo sapiens 9600.0 ChEMBL 10.1016/s0960-894x(02)00002-1 10.7270/Q27P8XPV 11858996 Itani, H; Ito, H; Sakata, Y; Hatakeyama, Y; Oohashi, H; Satoh, Y 2/22/2002 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50110416 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50110416&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10007341 104005199 CHEMBL350620 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5