BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50197992 CCC(CC)OC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)Cc3ccccc3)n2c1=O)-c1ccc(NC(C)=O)cc1 InChI=1S/C37H39FN4O4/c1-5-30(6-2)46-37(45)32-23-41(22-28-14-10-11-15-33(28)38)35-20-31(27-16-18-29(19-17-27)39-25(3)43)34(42(35)36(32)44)24-40(4)21-26-12-8-7-9-13-26/h7-20,23,30H,5-6,21-22,24H2,1-4H3,(H,39,43) ZSYJZAJZWKGBSG-UHFFFAOYSA-N 50109232 7-(4-Acetylamino-phenyl)-6-[(benzyl-methyl-amino)-methyl]-1-(2-fluoro-benzyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid 1-ethyl-propyl ester::CHEMBL130400 Gonadotropin-releasing hormone receptor Homo sapiens 4 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109232 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109232&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353228 104004242 CHEMBL130400 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50197993 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)NC(CC)CC)c(=O)n2c1CN(C)CCc1ccccn1 InChI=1S/C39H45FN6O3/c1-5-12-36(47)42-31-18-16-27(17-19-31)32-23-37-45(24-28-13-8-9-15-34(28)40)25-33(38(48)43-29(6-2)7-3)39(49)46(37)35(32)26-44(4)22-20-30-14-10-11-21-41-30/h8-11,13-19,21,23,25,29H,5-7,12,20,22,24,26H2,1-4H3,(H,42,47)(H,43,48) LNRZLOCRAANHBI-UHFFFAOYSA-N 50109233 7-(4-Butyrylamino-phenyl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid (1-ethyl-propyl)-amide::CHEMBL128810 Gonadotropin-releasing hormone receptor Homo sapiens 21 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109233 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109233&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353304 104004243 CHEMBL128810 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50197994 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)OCC)c(=O)n2c1CN(C)CCc1ccccn1 InChI=1S/C36H38FN5O4/c1-4-10-33(43)39-28-16-14-25(15-17-28)29-21-34-41(22-26-11-6-7-13-31(26)37)23-30(36(45)46-5-2)35(44)42(34)32(29)24-40(3)20-18-27-12-8-9-19-38-27/h6-9,11-17,19,21,23H,4-5,10,18,20,22,24H2,1-3H3,(H,39,43) MFTBZXGBGMFYDU-UHFFFAOYSA-N 50109234 7-(4-Butyrylamino-phenyl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid ethyl ester::CHEMBL130126 Gonadotropin-releasing hormone receptor Homo sapiens 1.2 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109234 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109234&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353248 104004244 CHEMBL130126 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50197995 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)NCCCc3ccccc3)c(=O)n2c1CN(C)CCc1ccccn1 InChI=1S/C43H45FN6O3/c1-3-12-40(51)47-35-21-19-32(20-22-35)36-27-41-49(28-33-16-7-8-18-38(33)44)29-37(42(52)46-25-11-15-31-13-5-4-6-14-31)43(53)50(41)39(36)30-48(2)26-23-34-17-9-10-24-45-34/h4-10,13-14,16-22,24,27,29H,3,11-12,15,23,25-26,28,30H2,1-2H3,(H,46,52)(H,47,51) VCLRZYGHUPYVKQ-UHFFFAOYSA-N 50109235 7-(4-Butyrylamino-phenyl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid (3-phenyl-propyl)-amide::CHEMBL130558 Gonadotropin-releasing hormone receptor Homo sapiens 1.1 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109235 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109235&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353277 104004245 CHEMBL130558 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50197996 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)NCCOC)c(=O)n2c1CN(C)CCc1ccccn1 InChI=1S/C37H41FN6O4/c1-4-9-34(45)41-29-15-13-26(14-16-29)30-22-35-43(23-27-10-5-6-12-32(27)38)24-31(36(46)40-19-21-48-3)37(47)44(35)33(30)25-42(2)20-17-28-11-7-8-18-39-28/h5-8,10-16,18,22,24H,4,9,17,19-21,23,25H2,1-3H3,(H,40,46)(H,41,45) ICWGWZNJTJKESB-UHFFFAOYSA-N 50109236 7-(4-Butyrylamino-phenyl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid (2-methoxy-ethyl)-amide::CHEMBL434621 Gonadotropin-releasing hormone receptor Homo sapiens 630 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109236 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109236&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353284 104004246 CHEMBL434621 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50197997 CCOC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)Cc3ccccc3)n2c1=O)-c1ccc(NC(=O)C(C)C)cc1 InChI=1S/C36H37FN4O4/c1-5-45-36(44)30-22-40(21-27-13-9-10-14-31(27)37)33-19-29(26-15-17-28(18-16-26)38-34(42)24(2)3)32(41(33)35(30)43)23-39(4)20-25-11-7-6-8-12-25/h6-19,22,24H,5,20-21,23H2,1-4H3,(H,38,42) LTDVFWLCCJRLEV-UHFFFAOYSA-N 50109237 6-[(benzyl-methyl-amino)-methyl]-1-(2-fluoro-benzyl)-7-(4-isobutyrylamino-phenyl)-4-oxo-1,4-dihydro-pyrroo[1,2-a]pyrimidine-3-carboxylic acid ethyl ester::6-[(Benzyl-methyl-amino)-methyl]-1-(2-fluoro-benzyl)-7-(4-isobutyrylamino-phenyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid ethyl ester::CHEMBL335610 Gonadotropin-releasing hormone receptor Homo sapiens 44 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109237 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109237&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353247 104004247 CHEMBL335610 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50197998 CCCCCCNC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)CCc3ccccn3)n2c1=O)-c1ccc(NC(=O)CCC)cc1 InChI=1S/C40H47FN6O3/c1-4-6-7-11-23-43-39(49)34-27-46(26-30-14-8-9-16-35(30)41)38-25-33(29-17-19-32(20-18-29)44-37(48)13-5-2)36(47(38)40(34)50)28-45(3)24-21-31-15-10-12-22-42-31/h8-10,12,14-20,22,25,27H,4-7,11,13,21,23-24,26,28H2,1-3H3,(H,43,49)(H,44,48) OJWVDKCOGMRFNT-UHFFFAOYSA-N 50109238 7-(4-Butyrylamino-phenyl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid hexylamide::CHEMBL340156 Gonadotropin-releasing hormone receptor Homo sapiens 3.3 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109238 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109238&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353285 104004248 CHEMBL340156 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50197999 CN(CCc1ccccn1)Cc1c(cc2n(Cc3ccccc3F)cc(C3=NC(C)(C)CO3)c(=O)n12)-c1ccc(cc1)[N+]([O-])=O |t:28| InChI=1S/C34H33FN6O4/c1-34(2)22-45-32(37-34)28-20-39(19-24-8-4-5-10-29(24)35)31-18-27(23-11-13-26(14-12-23)41(43)44)30(40(31)33(28)42)21-38(3)17-15-25-9-6-7-16-36-25/h4-14,16,18,20H,15,17,19,21-22H2,1-3H3 UZNLYQNSOXDZTB-UHFFFAOYSA-N 50109239 3-(4,4-Dimethyl-4,5-dihydro-oxazol-2-yl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-7-(4-nitro-phenyl)-1H-pyrrolo[1,2-a]pyrimidin-4-one::CHEMBL132339 Gonadotropin-releasing hormone receptor Homo sapiens 270 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109239 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109239&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353264 104004249 CHEMBL132339 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198000 CCOC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)Cc3ccccc3)n2c1=O)-c1ccc(N)cc1 InChI=1S/C32H31FN4O3/c1-3-40-32(39)27-20-36(19-24-11-7-8-12-28(24)33)30-17-26(23-13-15-25(34)16-14-23)29(37(30)31(27)38)21-35(2)18-22-9-5-4-6-10-22/h4-17,20H,3,18-19,21,34H2,1-2H3 IIJLFDXRKDQISI-UHFFFAOYSA-N 50109241 7-(4-Amino-phenyl)-6-[(benzyl-methyl-amino)-methyl]-1-(2-fluoro-benzyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid ethyl ester::CHEMBL130513 Gonadotropin-releasing hormone receptor Homo sapiens 190 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109241 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109241&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353246 104004251 CHEMBL130513 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198001 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)OC(CC)CC)c(=O)n2c1CN(C)C InChI=1S/C33H39FN4O4/c1-6-11-30(39)35-24-16-14-22(15-17-24)26-18-31-37(19-23-12-9-10-13-28(23)34)20-27(33(41)42-25(7-2)8-3)32(40)38(31)29(26)21-36(4)5/h9-10,12-18,20,25H,6-8,11,19,21H2,1-5H3,(H,35,39) LIPVNCFJDODAOI-UHFFFAOYSA-N 50109240 7-(4-Butyrylamino-phenyl)-6-dimethylaminomethyl-1-(2-fluoro-benzyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid 1-ethyl-propyl ester::CHEMBL131942 Gonadotropin-releasing hormone receptor Homo sapiens 130 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109240 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109240&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353254 104004250 CHEMBL131942 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198002 CCOC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)CCc3ccccn3)n2c1=O)-c1ccc(NC(=O)C(C)C)cc1 InChI=1S/C36H38FN5O4/c1-5-46-36(45)30-22-41(21-26-10-6-7-12-31(26)37)33-20-29(25-13-15-28(16-14-25)39-34(43)24(2)3)32(42(33)35(30)44)23-40(4)19-17-27-11-8-9-18-38-27/h6-16,18,20,22,24H,5,17,19,21,23H2,1-4H3,(H,39,43) VDKGSTLZQQFJLL-UHFFFAOYSA-N 50109242 1-(2-Fluoro-benzyl)-7-(4-isobutyrylamino-phenyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid ethyl ester::CHEMBL334537 Gonadotropin-releasing hormone receptor Homo sapiens 14 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109242 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109242&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353270 104004252 CHEMBL334537 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198003 CCOC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)Cc3ccccc3)n2c1=O)-c1ccc(OC)cc1 InChI=1S/C33H32FN3O4/c1-4-41-33(39)28-21-36(20-25-12-8-9-13-29(25)34)31-18-27(24-14-16-26(40-3)17-15-24)30(37(31)32(28)38)22-35(2)19-23-10-6-5-7-11-23/h5-18,21H,4,19-20,22H2,1-3H3 SONSAZMDMSBBOG-UHFFFAOYSA-N 50109243 6-[(Benzyl-methyl-amino)-methyl]-1-(2-fluoro-benzyl)-7-(4-methoxy-phenyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid ethyl ester::CHEMBL127502 Gonadotropin-releasing hormone receptor Homo sapiens 400 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109243 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109243&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353238 104004253 CHEMBL127502 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198004 CCOC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)Cc3ccccc3)n2c1=O)-c1ccc(cc1)[N+]([O-])=O InChI=1S/C32H29FN4O5/c1-3-42-32(39)27-20-35(19-24-11-7-8-12-28(24)33)30-17-26(23-13-15-25(16-14-23)37(40)41)29(36(30)31(27)38)21-34(2)18-22-9-5-4-6-10-22/h4-17,20H,3,18-19,21H2,1-2H3 MAEVTULPRYEOKV-UHFFFAOYSA-N 50109244 6-[(Benzyl-methyl-amino)-methyl]-1-(2-fluoro-benzyl)-7-(4-nitro-phenyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid ethyl ester::CHEMBL130195 Gonadotropin-releasing hormone receptor Homo sapiens 450 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109244 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109244&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353305 104004254 CHEMBL130195 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198005 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)OC(CC)CC)c(=O)n2c1CN(C)CCc1ccccn1 InChI=1S/C39H44FN5O4/c1-5-12-36(46)42-30-18-16-27(17-19-30)32-23-37-44(24-28-13-8-9-15-34(28)40)25-33(39(48)49-31(6-2)7-3)38(47)45(37)35(32)26-43(4)22-20-29-14-10-11-21-41-29/h8-11,13-19,21,23,25,31H,5-7,12,20,22,24,26H2,1-4H3,(H,42,46) FYVPNPLKRVWBFI-UHFFFAOYSA-N 50109245 7-(4-Butyrylamino-phenyl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid 1-ethyl-propyl ester::CHEMBL419998 Gonadotropin-releasing hormone receptor Homo sapiens 2.7 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109245 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109245&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 9831160 104004255 CHEMBL419998 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198006 CCOC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)Cc3ccccc3)n2c1=O)-c1ccc(NC(C)=O)cc1 InChI=1S/C34H33FN4O4/c1-4-43-34(42)29-21-38(20-26-12-8-9-13-30(26)35)32-18-28(25-14-16-27(17-15-25)36-23(2)40)31(39(32)33(29)41)22-37(3)19-24-10-6-5-7-11-24/h5-18,21H,4,19-20,22H2,1-3H3,(H,36,40) BUJZSMSRKYAWSB-UHFFFAOYSA-N 50109248 7-(4-Acetylamino-phenyl)-6-[(benzyl-methyl-amino)-methyl]-1-(2-fluoro-benzyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid ethyl ester::CHEMBL132616 Gonadotropin-releasing hormone receptor Homo sapiens 42 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109248 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109248&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353271 104004258 CHEMBL132616 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198007 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)OC(CC)CC)c(=O)n2c1CN(C)CCN(CC)CC InChI=1S/C38H50FN5O4/c1-7-14-35(45)40-29-19-17-27(18-20-29)31-23-36-43(24-28-15-12-13-16-33(28)39)25-32(38(47)48-30(8-2)9-3)37(46)44(36)34(31)26-41(6)21-22-42(10-4)11-5/h12-13,15-20,23,25,30H,7-11,14,21-22,24,26H2,1-6H3,(H,40,45) IVISFMVSDRFNIO-UHFFFAOYSA-N 50109249 7-(4-Butyrylamino-phenyl)-6-{[(2-diethylamino-ethyl)-methyl-amino]-methyl}-1-(2-fluoro-benzyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid 1-ethyl-propyl ester::CHEMBL434995 Gonadotropin-releasing hormone receptor Homo sapiens 5.8 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109249 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109249&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353249 104004259 CHEMBL434995 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198008 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)NC3CCCC3)c(=O)n2c1CN(C)CCc1ccccn1 InChI=1S/C39H43FN6O3/c1-3-10-36(47)42-31-18-16-27(17-19-31)32-23-37-45(24-28-11-4-7-15-34(28)40)25-33(38(48)43-30-13-5-6-14-30)39(49)46(37)35(32)26-44(2)22-20-29-12-8-9-21-41-29/h4,7-9,11-12,15-19,21,23,25,30H,3,5-6,10,13-14,20,22,24,26H2,1-2H3,(H,42,47)(H,43,48) DCLRIOIGKNCEAU-UHFFFAOYSA-N 50109247 7-(4-Butyrylamino-phenyl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid cyclopentylamide::CHEMBL434423 Gonadotropin-releasing hormone receptor Homo sapiens 9.2 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109247 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109247&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353288 104004257 CHEMBL434423 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198009 CCCCNC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)Cc3ccccc3)n2c1=O)-c1ccc(NC(=O)CCC)cc1 InChI=1S/C38H42FN5O3/c1-4-6-21-40-37(46)32-25-43(24-29-15-10-11-16-33(29)39)36-22-31(28-17-19-30(20-18-28)41-35(45)12-5-2)34(44(36)38(32)47)26-42(3)23-27-13-8-7-9-14-27/h7-11,13-20,22,25H,4-6,12,21,23-24,26H2,1-3H3,(H,40,46)(H,41,45) MVEIAQQXTGICDD-UHFFFAOYSA-N 50109246 6-[(Benzyl-methyl-amino)-methyl]-7-(4-butyrylamino-phenyl)-1-(2-fluoro-benzyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid butylamide::CHEMBL339273 Gonadotropin-releasing hormone receptor Homo sapiens 154 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109246 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109246&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353266 104004256 CHEMBL339273 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198010 CCOC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)CCc3ccccn3)n2c1=O)-c1ccc(OC)cc1 InChI=1S/C33H33FN4O4/c1-4-42-33(40)28-21-37(20-24-9-5-6-11-29(24)34)31-19-27(23-12-14-26(41-3)15-13-23)30(38(31)32(28)39)22-36(2)18-16-25-10-7-8-17-35-25/h5-15,17,19,21H,4,16,18,20,22H2,1-3H3 CYCBXKJGMMXKHS-UHFFFAOYSA-N 50109250 1-(2-Fluoro-benzyl)-7-(4-methoxy-phenyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid ethyl ester::CHEMBL324375 Gonadotropin-releasing hormone receptor Homo sapiens 55 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109250 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109250&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44343931 104004260 CHEMBL324375 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198011 CCC(CC)OC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)CCc3ccccn3)n2c1=O)-c1ccc(NC(C)=O)cc1 InChI=1S/C37H40FN5O4/c1-5-30(6-2)47-37(46)32-23-42(22-27-11-7-8-13-33(27)38)35-21-31(26-14-16-29(17-15-26)40-25(3)44)34(43(35)36(32)45)24-41(4)20-18-28-12-9-10-19-39-28/h7-17,19,21,23,30H,5-6,18,20,22,24H2,1-4H3,(H,40,44) FGWGTCUSAKNWBN-UHFFFAOYSA-N 50109252 7-(4-Acetylamino-phenyl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid 1-ethyl-propyl ester::CHEMBL308910 Gonadotropin-releasing hormone receptor Homo sapiens 2.8 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109252 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109252&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 10077844 104004262 CHEMBL308910 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198012 CCCCNC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)CCc3ccccn3)n2c1=O)-c1ccc(NC(=O)CCC)cc1 InChI=1S/C38H43FN6O3/c1-4-6-20-41-37(47)32-25-44(24-28-12-7-8-14-33(28)39)36-23-31(27-15-17-30(18-16-27)42-35(46)11-5-2)34(45(36)38(32)48)26-43(3)22-19-29-13-9-10-21-40-29/h7-10,12-18,21,23,25H,4-6,11,19-20,22,24,26H2,1-3H3,(H,41,47)(H,42,46) JWRZHINGGASFEC-UHFFFAOYSA-N 50109251 7-(4-Butyrylamino-phenyl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid butylamide::CHEMBL131182 Gonadotropin-releasing hormone receptor Homo sapiens 10 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109251 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109251&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353201 104004261 CHEMBL131182 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198013 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)OC(CC)CC)c(=O)n2c1CN(C)CCc1ccccc1 InChI=1S/C40H45FN4O4/c1-5-13-37(46)42-31-20-18-29(19-21-31)33-24-38-44(25-30-16-11-12-17-35(30)41)26-34(40(48)49-32(6-2)7-3)39(47)45(38)36(33)27-43(4)23-22-28-14-9-8-10-15-28/h8-12,14-21,24,26,32H,5-7,13,22-23,25,27H2,1-4H3,(H,42,46) MALCCJMOWDULCW-UHFFFAOYSA-N 50109255 7-(4-Butyrylamino-phenyl)-1-(2-fluoro-benzyl)-6-[(methyl-phenethyl-amino)-methyl]-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid 1-ethyl-propyl ester::CHEMBL337919 Gonadotropin-releasing hormone receptor Homo sapiens 2.1 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109255 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109255&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353262 104004265 CHEMBL337919 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198014 CCC(CC)OC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)Cc3ccccc3)n2c1=O)-c1ccc(N)cc1 InChI=1S/C35H37FN4O3/c1-4-28(5-2)43-35(42)30-22-39(21-26-13-9-10-14-31(26)36)33-19-29(25-15-17-27(37)18-16-25)32(40(33)34(30)41)23-38(3)20-24-11-7-6-8-12-24/h6-19,22,28H,4-5,20-21,23,37H2,1-3H3 VJPLLPRJJWJKBP-UHFFFAOYSA-N 50109258 7-(4-Amino-phenyl)-6-[(benzyl-methyl-amino)-methyl]-1-(2-fluoro-benzyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid 1-ethyl-propyl ester::CHEMBL130487 Gonadotropin-releasing hormone receptor Homo sapiens 100 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109258 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109258&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353229 104004268 CHEMBL130487 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198015 CCC(CC)OC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)Cc3ccccc3)n2c1=O)-c1ccc(OC)cc1 InChI=1S/C36H38FN3O4/c1-5-28(6-2)44-36(42)31-23-39(22-27-14-10-11-15-32(27)37)34-20-30(26-16-18-29(43-4)19-17-26)33(40(34)35(31)41)24-38(3)21-25-12-8-7-9-13-25/h7-20,23,28H,5-6,21-22,24H2,1-4H3 QNFZINQSZYSEGF-UHFFFAOYSA-N 50109257 6-[(Benzyl-methyl-amino)-methyl]-1-(2-fluoro-benzyl)-7-(4-methoxy-phenyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid 1-ethyl-propyl ester::CHEMBL337865 Gonadotropin-releasing hormone receptor Homo sapiens 62 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109257&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353231 104004267 CHEMBL337865 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198016 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)OC(CC)CC)c(=O)n2c1CN(C)Cc1ccccc1 InChI=1S/C39H43FN4O4/c1-5-13-36(45)41-30-20-18-28(19-21-30)32-22-37-43(24-29-16-11-12-17-34(29)40)25-33(39(47)48-31(6-2)7-3)38(46)44(37)35(32)26-42(4)23-27-14-9-8-10-15-27/h8-12,14-22,25,31H,5-7,13,23-24,26H2,1-4H3,(H,41,45) GKAJTCCMZCXKFH-UHFFFAOYSA-N 50109253 6-[(Benzyl-methyl-amino)-methyl]-7-(4-butyrylamino-phenyl)-1-(2-fluoro-benzyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid 1-ethyl-propyl ester::CHEMBL335647 Gonadotropin-releasing hormone receptor Homo sapiens 3.8 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109253 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109253&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353258 104004263 CHEMBL335647 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198017 CCC(CC)OC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)CCc3ccccn3)n2c1=O)-c1ccc(OC)cc1 InChI=1S/C36H39FN4O4/c1-5-28(6-2)45-36(43)31-23-40(22-26-11-7-8-13-32(26)37)34-21-30(25-14-16-29(44-4)17-15-25)33(41(34)35(31)42)24-39(3)20-18-27-12-9-10-19-38-27/h7-17,19,21,23,28H,5-6,18,20,22,24H2,1-4H3 QQTGURBPGZKXMQ-UHFFFAOYSA-N 50109254 1-(2-Fluoro-benzyl)-7-(4-methoxy-phenyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid 1-ethyl-propyl ester::CHEMBL337748 Gonadotropin-releasing hormone receptor Homo sapiens 14 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109254 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109254&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353230 104004264 CHEMBL337748 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198018 CN(CCc1ccccn1)Cc1c(cc2n(Cc3ccccc3F)cc(-c3nc(co3)C(C)(C)C)c(=O)n12)-c1ccc(cc1)[N+]([O-])=O InChI=1S/C36H35FN6O4/c1-36(2,3)32-23-47-34(39-32)29-21-41(20-25-9-5-6-11-30(25)37)33-19-28(24-12-14-27(15-13-24)43(45)46)31(42(33)35(29)44)22-40(4)18-16-26-10-7-8-17-38-26/h5-15,17,19,21,23H,16,18,20,22H2,1-4H3 PUMDQJFTFGAXSD-UHFFFAOYSA-N 50109256 3-(4-tert-Butyl-4,5-dihydro-oxazol-2-yl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-7-(4-nitro-phenyl)-1H-pyrrolo[1,2-a]pyrimidin-4-one::CHEMBL132338 Gonadotropin-releasing hormone receptor Homo sapiens 64 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109256 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109256&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353263 104004266 CHEMBL132338 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198019 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)NCCCc3ccccc3)c(=O)n2c1CN(C)Cc1ccccc1 InChI=1S/C43H44FN5O3/c1-3-13-40(50)46-35-23-21-33(22-24-35)36-26-41-48(28-34-19-10-11-20-38(34)44)29-37(42(51)45-25-12-18-31-14-6-4-7-15-31)43(52)49(41)39(36)30-47(2)27-32-16-8-5-9-17-32/h4-11,14-17,19-24,26,29H,3,12-13,18,25,27-28,30H2,1-2H3,(H,45,51)(H,46,50) KEJQQOSNDBRTMX-UHFFFAOYSA-N 50109260 6-[(Benzyl-methyl-amino)-methyl]-7-(4-butyrylamino-phenyl)-1-(2-fluoro-benzyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid (3-phenyl-propyl)-amide::CHEMBL339468 Gonadotropin-releasing hormone receptor Homo sapiens 17 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109260 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109260&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353276 104004270 CHEMBL339468 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198020 CCCC(=O)Nc1ccc(cc1)-c1cc2n(Cc3ccccc3F)cc(C(=O)NC3CCCCC3)c(=O)n2c1CN(C)CCc1ccccn1 InChI=1S/C40H45FN6O3/c1-3-11-37(48)43-32-19-17-28(18-20-32)33-24-38-46(25-29-12-7-8-16-35(29)41)26-34(39(49)44-31-14-5-4-6-15-31)40(50)47(38)36(33)27-45(2)23-21-30-13-9-10-22-42-30/h7-10,12-13,16-20,22,24,26,31H,3-6,11,14-15,21,23,25,27H2,1-2H3,(H,43,48)(H,44,49) DLRXDIPMXJSRQO-UHFFFAOYSA-N 50109259 7-(4-Butyrylamino-phenyl)-1-(2-fluoro-benzyl)-6-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid cyclohexylamide::CHEMBL131127 Gonadotropin-releasing hormone receptor Homo sapiens 32 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109259 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109259&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353200 104004269 CHEMBL131127 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50198021 CCCCNC(=O)c1cn(Cc2ccccc2F)c2cc(c(CN(C)CCN(CC)CC)n2c1=O)-c1ccc(NC(=O)CCC)cc1 InChI=1S/C37H49FN6O3/c1-6-10-20-39-36(46)31-25-43(24-28-14-11-12-15-32(28)38)35-23-30(27-16-18-29(19-17-27)40-34(45)13-7-2)33(44(35)37(31)47)26-41(5)21-22-42(8-3)9-4/h11-12,14-19,23,25H,6-10,13,20-22,24,26H2,1-5H3,(H,39,46)(H,40,45) RMTWNPZVHIZOGT-UHFFFAOYSA-N 50109261 7-(4-Butyrylamino-phenyl)-6-{[(2-diethylamino-ethyl)-methyl-amino]-methyl}-1-(2-fluoro-benzyl)-4-oxo-1,4-dihydro-pyrrolo[1,2-a]pyrimidine-3-carboxylic acid butylamide::CHEMBL132392 Gonadotropin-releasing hormone receptor Homo sapiens 440 ChEMBL 10.1016/s0960-894x(01)00780-6 10.7270/Q2542MXV 11814807 Zhu, YF; Wilcoxen, K; Saunders, J; Guo, Z; Gao, Y; Connors, PJ; Gross, TD; Tucci, FC; Struthers, RS; Reinhart, GJ; Xie, Q; Chen, C 1/29/2002 11/10/2009 Neurocrine Biosciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50109261 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50109261&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44353265 104004271 CHEMBL132392 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644