BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50194115 OC(=O)CN\N=c1/n(Cc2ccc(cc2)C(F)(F)F)c2ccccc2n1C(=O)C(O)=O InChI=1S/C19H15F3N4O5/c20-19(21,22)12-7-5-11(6-8-12)10-25-13-3-1-2-4-14(13)26(16(29)17(30)31)18(25)24-23-9-15(27)28/h1-8,23H,9-10H2,(H,27,28)(H,30,31) AVTVZIZTXXXGLB-UHFFFAOYSA-N 50107134 [2-(Carboxymethyl-hydrazono)-3-(4-trifluoromethyl-benzyl)-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL136855 Aldo-keto reductase family 1 member B1 Rattus norvegicus 2630 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107134 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107134&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10873783 104002555 CHEMBL136855 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194116 OC(=O)Cn1nc2n(Cc3ccc(Br)cc3F)c3ccccc3n2c(=O)c1=O InChI=1S/C18H12BrFN4O4/c19-11-6-5-10(12(20)7-11)8-22-13-3-1-2-4-14(13)24-17(28)16(27)23(9-15(25)26)21-18(22)24/h1-7H,8-9H2,(H,25,26) CGRLDUWKCSABGI-UHFFFAOYSA-N 50107135 [10-(4-Bromo-2-fluoro-benzyl)-3,4-dioxo-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl]-acetic acid::CHEMBL136825 Aldo-keto reductase family 1 member B1 Rattus norvegicus 4470.0 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107135 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107135&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10884799 104002556 CHEMBL136825 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194117 OC(=O)CN\N=c1/n(CC(O)=O)c2ccccc2n1C(=O)C(O)=O InChI=1S/C13H12N4O7/c18-9(19)5-14-15-13-16(6-10(20)21)7-3-1-2-4-8(7)17(13)11(22)12(23)24/h1-4,14H,5-6H2,(H,18,19)(H,20,21)(H,23,24) LEELBDRTTZHSRW-UHFFFAOYSA-N 50107136 [3-Carboxymethyl-2-(carboxymethyl-hydrazono)-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL336224 Aldo-keto reductase family 1 member B1 Rattus norvegicus 236000 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107136 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107136&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11759483 104002557 CHEMBL336224 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194118 OC(=O)Cc1nnc2[nH]c3ccccc3n2c1=O InChI=1S/C11H8N4O3/c16-9(17)5-7-10(18)15-8-4-2-1-3-6(8)12-11(15)14-13-7/h1-4H,5H2,(H,12,14)(H,16,17) ZHQGIYOHDXLBGJ-UHFFFAOYSA-N 50107137 (4-Oxo-4,10-dihydro-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-3-yl)-acetic acid::CHEMBL137540 Aldo-keto reductase family 1 member B1 Rattus norvegicus 35900 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107137 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107137&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11032104 104002558 CHEMBL137540 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194119 OC(=O)Cn1c2ccccc2n2c1nn(CC(O)=O)c(=O)c2=O InChI=1S/C13H10N4O6/c18-9(19)5-15-7-3-1-2-4-8(7)17-12(23)11(22)16(6-10(20)21)14-13(15)17/h1-4H,5-6H2,(H,18,19)(H,20,21) BLGZYAXBISMETE-UHFFFAOYSA-N 50107138 (10-Carboxymethyl-3,4-dioxo-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl)-acetic acid::CHEMBL344409 Aldo-keto reductase family 1 member B1 Rattus norvegicus 13500 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107138 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107138&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11001652 104002559 CHEMBL344409 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194120 OC(=O)Cn1nc2n(Cc3ccc(F)c(F)c3)c3ccccc3n2c(=O)c1=O InChI=1S/C18H12F2N4O4/c19-11-6-5-10(7-12(11)20)8-22-13-3-1-2-4-14(13)24-17(28)16(27)23(9-15(25)26)21-18(22)24/h1-7H,8-9H2,(H,25,26) DLABIGCYCHCTDR-UHFFFAOYSA-N 50107139 [10-(3,4-Difluoro-benzyl)-3,4-dioxo-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl]-acetic acid::CHEMBL134308 Aldo-keto reductase family 1 member B1 Rattus norvegicus 4420 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107139 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107139&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11825203 104002560 CHEMBL134308 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194121 CN(CC(=O)O)C(=S)c1cccc2c1ccc(c2C(F)(F)F)OC InChI=1S/C16H14F3NO3S/c1-20(8-13(21)22)15(24)11-5-3-4-10-9(11)6-7-12(23-2)14(10)16(17,18)19/h3-7H,8H2,1-2H3,(H,21,22) LUBHDINQXIHVLS-UHFFFAOYSA-N 16314 N-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]carbonothioyl}-N-methylglycine::Alredase::2-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]-N-methylmethanethioamido}acetic acid::CHEMBL436::Tolrestat Aldo-keto reductase family 1 member B1 Rattus norvegicus 50 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16314 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16314&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search TOL 1AE4,1AH3,1ZUA,2FZB,2FZD,2PDL,6KIK 53359 46516555 CHEMBL436 DB02383 C01621 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194122 OC(=O)CN\N=c1/n(Cc2ccc(F)cc2)c2ccccc2n1C(=O)C(O)=O InChI=1S/C18H15FN4O5/c19-12-7-5-11(6-8-12)10-22-13-3-1-2-4-14(13)23(16(26)17(27)28)18(22)21-20-9-15(24)25/h1-8,20H,9-10H2,(H,24,25)(H,27,28) WOGMMKWBJXZIJP-UHFFFAOYSA-N 50107140 [2-(Carboxymethyl-hydrazono)-3-(4-fluoro-benzyl)-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL343594 Aldo-keto reductase family 1 member B1 Rattus norvegicus 14800 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107140 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107140&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11090324 104002561 CHEMBL343594 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194123 OC(=O)Cn1nc2n(Cc3ccccc3)c3ccccc3n2c(=O)c1=O InChI=1S/C18H14N4O4/c23-15(24)11-21-16(25)17(26)22-14-9-5-4-8-13(14)20(18(22)19-21)10-12-6-2-1-3-7-12/h1-9H,10-11H2,(H,23,24) UYKLQQWWOWXMFD-UHFFFAOYSA-N 50107141 (10-Benzyl-3,4-dioxo-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl)-acetic acid::CHEMBL342382 Aldo-keto reductase family 1 member B1 Rattus norvegicus 360 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107141 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107141&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 9975154 104002562 CHEMBL342382 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194124 OC(=O)Cn1nc2n(Cc3ccc(F)cc3)c3ccccc3n2c(=O)c1=O InChI=1S/C18H13FN4O4/c19-12-7-5-11(6-8-12)9-21-13-3-1-2-4-14(13)23-17(27)16(26)22(10-15(24)25)20-18(21)23/h1-8H,9-10H2,(H,24,25) WNALULCFVSVPKK-UHFFFAOYSA-N 50107142 [10-(4-Fluoro-benzyl)-3,4-dioxo-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl]-acetic acid::CHEMBL136723 Aldo-keto reductase family 1 member B1 Rattus norvegicus 4580 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107142 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107142&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10915573 104002563 CHEMBL136723 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194125 Cn1c2ccccc2n2c1nnc(CC(O)=O)c2=O InChI=1S/C12H10N4O3/c1-15-8-4-2-3-5-9(8)16-11(19)7(6-10(17)18)13-14-12(15)16/h2-5H,6H2,1H3,(H,17,18) SGNRUTAGHPSKQV-UHFFFAOYSA-N 50107143 (10-Methyl-4-oxo-4,10-dihydro-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-3-yl)-acetic acid::CHEMBL140407 Aldo-keto reductase family 1 member B1 Rattus norvegicus 17000 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107143 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107143&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10945100 104002564 CHEMBL140407 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194126 OC(=O)CN\N=c1/n(Cc2ccc(Cl)cc2)c2ccccc2n1C(=O)C(O)=O InChI=1S/C18H15ClN4O5/c19-12-7-5-11(6-8-12)10-22-13-3-1-2-4-14(13)23(16(26)17(27)28)18(22)21-20-9-15(24)25/h1-8,20H,9-10H2,(H,24,25)(H,27,28) GIUHZKVBALEXFS-UHFFFAOYSA-N 50107145 [2-(Carboxymethyl-hydrazono)-3-(4-chloro-benzyl)-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL135144 Aldo-keto reductase family 1 member B1 Rattus norvegicus 10000 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107145 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107145&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11069472 104002566 CHEMBL135144 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194127 OC(=O)Cc1nnc2n(Cc3ccccc3)c3ccccc3n2c1=O InChI=1S/C18H14N4O3/c23-16(24)10-13-17(25)22-15-9-5-4-8-14(15)21(18(22)20-19-13)11-12-6-2-1-3-7-12/h1-9H,10-11H2,(H,23,24) GXYLQKGHRLRVOB-UHFFFAOYSA-N 50107146 (10-Benzyl-4-oxo-4,10-dihydro-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-3-yl)-acetic acid::CHEMBL344845 Aldo-keto reductase family 1 member B1 Rattus norvegicus 5440 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107146 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107146&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11142208 104002567 CHEMBL344845 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194128 COc1ccc(Cn2c3ccccc3n3c2nn(CC(O)=O)c(=O)c3=O)cc1 InChI=1S/C19H16N4O5/c1-28-13-8-6-12(7-9-13)10-21-14-4-2-3-5-15(14)23-18(27)17(26)22(11-16(24)25)20-19(21)23/h2-9H,10-11H2,1H3,(H,24,25) IMGIQWNUYCZEGW-UHFFFAOYSA-N 50107144 [10-(4-Methoxy-benzyl)-3,4-dioxo-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl]-acetic acid::CHEMBL335729 Aldo-keto reductase family 1 member B1 Rattus norvegicus 42600.0 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107144 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107144&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11760679 104002565 CHEMBL335729 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194129 Fc1ccc2OCC[C@]3(NC(=O)NC3=O)c2c1 |r| InChI=1S/C11H9FN2O3/c12-6-1-2-8-7(5-6)11(3-4-17-8)9(15)13-10(16)14-11/h1-2,5H,3-4H2,(H2,13,14,15,16) LXANPKRCLVQAOG-UHFFFAOYSA-N 16312 CHEMBL266497::(4S)-6-fluoro-2,3-dihydrospiro[1-benzopyran-4,4'-imidazolidine]-2',5'-dione::Sorbinil Aldo-keto reductase family 1 member B1 Rattus norvegicus 650 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16312 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16312&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 337359 46509502 CHEMBL266497 DB02712 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194130 CCCn1c2ccccc2n2c1nn(CC(O)=O)c(=O)c2=O InChI=1S/C14H14N4O4/c1-2-7-16-9-5-3-4-6-10(9)18-13(22)12(21)17(8-11(19)20)15-14(16)18/h3-6H,2,7-8H2,1H3,(H,19,20) ZEVDLWNKNMEOCH-UHFFFAOYSA-N 50107149 (3,4-Dioxo-10-propyl-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl)-acetic acid::CHEMBL136785 Aldo-keto reductase family 1 member B1 Rattus norvegicus 37200 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107149 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107149&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11001123 104002570 CHEMBL136785 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194131 CCCn1c2ccccc2n(C(=O)C(O)=O)\c1=N\NCC(O)=O InChI=1S/C14H16N4O5/c1-2-7-17-9-5-3-4-6-10(9)18(12(21)13(22)23)14(17)16-15-8-11(19)20/h3-6,15H,2,7-8H2,1H3,(H,19,20)(H,22,23) MDAQFJQSNWYZOE-UHFFFAOYSA-N 50107148 [2-(Carboxymethyl-hydrazono)-3-propyl-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL434249 Aldo-keto reductase family 1 member B1 Rattus norvegicus 46500.0 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107148 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107148&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11141738 104002569 CHEMBL434249 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194132 Cc1ccc(Cn2c3ccccc3n(C(=O)C(O)=O)\c2=N\NCC(O)=O)cc1 InChI=1S/C19H18N4O5/c1-12-6-8-13(9-7-12)11-22-14-4-2-3-5-15(14)23(17(26)18(27)28)19(22)21-20-10-16(24)25/h2-9,20H,10-11H2,1H3,(H,24,25)(H,27,28) YFAXOAKSILAIGV-UHFFFAOYSA-N 50107147 [2-(Carboxymethyl-hydrazono)-3-(4-methyl-benzyl)-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL434229 Aldo-keto reductase family 1 member B1 Rattus norvegicus 45900 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107147 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107147&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10915930 104002568 CHEMBL434229 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194133 Cn1c2ccccc2n2c1nn(CC(O)=O)c(=O)c2=O InChI=1S/C12H10N4O4/c1-14-7-4-2-3-5-8(7)16-11(20)10(19)15(6-9(17)18)13-12(14)16/h2-5H,6H2,1H3,(H,17,18) WYJPSCDIVLFEEC-UHFFFAOYSA-N 50107151 (10-Methyl-3,4-dioxo-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl)-acetic acid::CHEMBL343738 Aldo-keto reductase family 1 member B1 Rattus norvegicus 24800 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107151 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107151&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11076614 104002572 CHEMBL343738 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194134 c1cc(c(cc1C2=C(C(=O)c3c(cc(cc3O2)O)O)O)O)O InChI=1S/C15H10O7/c16-7-4-10(19)12-11(5-7)22-15(14(21)13(12)20)6-1-2-8(17)9(18)3-6/h1-5,16-19,21H REFJWTPEDVJJIY-UHFFFAOYSA-N 7460 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone;hydrate::2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one::CHEMBL50::2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromen-4-one::Quercetin::Quercetin (21)::Quercetin (Qur)::US9180183, Quercetin::Quercetin (10)::med.21724, Compound 4::US11021454, Compound Quercetin Aldo-keto reductase family 1 member B1 Rattus norvegicus 7810 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7460 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7460&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search QUE 1E8W,1GP6,1H1I,2C9Z,2HCK,2JJ2,2MS6,2N6C,2O3P,2UXH,3BPT,3BXX,3CF8,3LJ0,3LM5,3NVY,4DFU,4LMU,4MRA,4WNJ,5A4V,5AUW,5FLI,5FLJ,5XG4,6AWS,6B1D,6IJD,6M89,6QCD,6QCN,6TTA,7VUM,8GQT,8SFW 5280343 11108251 CHEMBL50 DB04216 C00389 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194135 Cc1ccc(Cn2c3ccccc3n3c2nn(CC(O)=O)c(=O)c3=O)cc1 InChI=1S/C19H16N4O4/c1-12-6-8-13(9-7-12)10-21-14-4-2-3-5-15(14)23-18(27)17(26)22(11-16(24)25)20-19(21)23/h2-9H,10-11H2,1H3,(H,24,25) SUYKPDIZCHXYHD-UHFFFAOYSA-N 50107150 [10-(4-Methyl-benzyl)-3,4-dioxo-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl]-acetic acid::CHEMBL136884 Aldo-keto reductase family 1 member B1 Rattus norvegicus 13300 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107150 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107150&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11079017 104002571 CHEMBL136884 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194136 OC(=O)Cn1nc2n(Cc3ccc(Cl)cc3)c3ccccc3n2c(=O)c1=O InChI=1S/C18H13ClN4O4/c19-12-7-5-11(6-8-12)9-21-13-3-1-2-4-14(13)23-17(27)16(26)22(10-15(24)25)20-18(21)23/h1-8H,9-10H2,(H,24,25) NTYVMINGFZUTQC-UHFFFAOYSA-N 50107153 [10-(4-Chloro-benzyl)-3,4-dioxo-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl]-acetic acid::CHEMBL334916 Aldo-keto reductase family 1 member B1 Rattus norvegicus 4150 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107153 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107153&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10872720 104002574 CHEMBL334916 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194137 Cn1c2ccccc2n(C(=O)C(O)=O)\c1=N\NCC(O)=O InChI=1S/C12H12N4O5/c1-15-7-4-2-3-5-8(7)16(10(19)11(20)21)12(15)14-13-6-9(17)18/h2-5,13H,6H2,1H3,(H,17,18)(H,20,21) YTEDAFWAHDRDHY-UHFFFAOYSA-N 50107152 [2-(Carboxymethyl-hydrazono)-3-methyl-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL136285 Aldo-keto reductase family 1 member B1 Rattus norvegicus 108600 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107152 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107152&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10957277 104002573 CHEMBL136285 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194138 OC(=O)CN\N=c1/n(Cc2ccc(Br)cc2F)c2ccccc2n1C(=O)C(O)=O InChI=1S/C18H14BrFN4O5/c19-11-6-5-10(12(20)7-11)9-23-13-3-1-2-4-14(13)24(16(27)17(28)29)18(23)22-21-8-15(25)26/h1-7,21H,8-9H2,(H,25,26)(H,28,29) UKVZTDNCEQKKKO-UHFFFAOYSA-N 50107155 [3-(4-Bromo-2-fluoro-benzyl)-2-(carboxymethyl-hydrazono)-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL136157 Aldo-keto reductase family 1 member B1 Rattus norvegicus 12500 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107155 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107155&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10972651 104002576 CHEMBL136157 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194139 OC(=O)Cn1nc2n(Cc3ccc(cc3)C(F)(F)F)c3ccccc3n2c(=O)c1=O InChI=1S/C19H13F3N4O4/c20-19(21,22)12-7-5-11(6-8-12)9-24-13-3-1-2-4-14(13)26-17(30)16(29)25(10-15(27)28)23-18(24)26/h1-8H,9-10H2,(H,27,28) WOSNEJFXJQWIFZ-UHFFFAOYSA-N 50107156 [3,4-Dioxo-10-(4-trifluoromethyl-benzyl)-3,4-dihydro-10H-benzo[4,5]imidazo[2,1-c][1,2,4]triazin-2-yl]-acetic acid::CHEMBL137661 Aldo-keto reductase family 1 member B1 Rattus norvegicus 23900 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107156 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107156&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10895028 104002577 CHEMBL137661 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194140 OC(=O)CN\N=c1/n(Cc2ccc(F)c(F)c2)c2ccccc2n1C(=O)C(O)=O InChI=1S/C18H14F2N4O5/c19-11-6-5-10(7-12(11)20)9-23-13-3-1-2-4-14(13)24(16(27)17(28)29)18(23)22-21-8-15(25)26/h1-7,21H,8-9H2,(H,25,26)(H,28,29) ZZAGKISTDZNKHO-UHFFFAOYSA-N 50107154 [2-(Carboxymethyl-hydrazono)-3-(3,4-difluoro-benzyl)-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL335578 Aldo-keto reductase family 1 member B1 Rattus norvegicus 9720.0 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107154 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107154&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11069492 104002575 CHEMBL335578 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194141 OC(=O)CN\N=c1/n(Cc2ccccc2)c2ccccc2n1C(=O)C(O)=O InChI=1S/C18H16N4O5/c23-15(24)10-19-20-18-21(11-12-6-2-1-3-7-12)13-8-4-5-9-14(13)22(18)16(25)17(26)27/h1-9,19H,10-11H2,(H,23,24)(H,26,27) UOVICTJGHCTYEC-UHFFFAOYSA-N 50107158 [3-Benzyl-2-(carboxymethyl-hydrazono)-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL136452 Aldo-keto reductase family 1 member B1 Rattus norvegicus 4500 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107158 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107158&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11728312 104002579 CHEMBL136452 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50194142 COc1ccc(Cn2c3ccccc3n(C(=O)C(O)=O)\c2=N\NCC(O)=O)cc1 InChI=1S/C19H18N4O6/c1-29-13-8-6-12(7-9-13)11-22-14-4-2-3-5-15(14)23(17(26)18(27)28)19(22)21-20-10-16(24)25/h2-9,20H,10-11H2,1H3,(H,24,25)(H,27,28) OYRPGABLDZHYBY-UHFFFAOYSA-N 50107157 [2-(Carboxymethyl-hydrazono)-3-(4-methoxy-benzyl)-2,3-dihydro-benzoimidazol-1-yl]-oxo-acetic acid::CHEMBL136083 Aldo-keto reductase family 1 member B1 Rattus norvegicus 44500 ChEMBL 10.1021/jm0109210 10.7270/Q21N80FB 11728182 Da Settimo, F; Primofiore, G; Da Settimo, A; La Motta, C; Taliani, S; Simorini, F; Novellino, E; Greco, G; Lavecchia, A; Boldrini, E 11/30/2001 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50107157 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50107157&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 11143789 104002578 CHEMBL136083 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943