BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 14753 Cc1ccc(Cn2cnc(c2)-c2cccs2)cc1 InChI=1S/C15H14N2S/c1-12-4-6-13(7-5-12)9-17-10-14(16-11-17)15-3-2-8-18-15/h2-8,10-11H,9H2,1H3 UMOFOLLUKPBVQG-UHFFFAOYSA-N 8738 1-[(4-methylphenyl)methyl]-4-(thiophen-2-yl)-1H-imidazole::Disubstituted imidazole 1 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 1240 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8738 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8738&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 446185 11109477 DB03030 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14754 COc1ccc(cc1)-c1cn(Cc2ccc(C)cc2)cn1 InChI=1S/C18H18N2O/c1-14-3-5-15(6-4-14)11-20-12-18(19-13-20)16-7-9-17(21-2)10-8-16/h3-10,12-13H,11H2,1-2H3 XAEAKTBHLFKUKT-UHFFFAOYSA-N 8739 4-(4-methoxyphenyl)-1-[(4-methylphenyl)methyl]-1H-imidazole::Disubstituted imidazole 4 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 360 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8739 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8739&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539900 11109478 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14755 O=N(=O)c1cccc(Cn2cnc(c2)-c2ccsc2)c1 InChI=1S/C14H11N3O2S/c18-17(19)13-3-1-2-11(6-13)7-16-8-14(15-10-16)12-4-5-20-9-12/h1-6,8-10H,7H2 UNSOKCLOXGBFRH-UHFFFAOYSA-N 8740 1-[(3-nitrophenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 8 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 14700 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8740 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8740&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539901 11109479 C06058 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14756 Nc1ccc(Cn2cnc(c2)-c2ccsc2)cc1 InChI=1S/C14H13N3S/c15-13-3-1-11(2-4-13)7-17-8-14(16-10-17)12-5-6-18-9-12/h1-6,8-10H,7,15H2 LHODHAYQPAPVED-UHFFFAOYSA-N 8741 4-{[4-(thiophen-3-yl)-1H-imidazol-1-yl]methyl}aniline::Disubstituted imidazole 20 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 2030 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8741 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8741&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539902 11109480 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14757 COc1ccc(Cn2cnc(c2)-c2ccsc2)cc1 InChI=1S/C15H14N2OS/c1-18-14-4-2-12(3-5-14)8-17-9-15(16-11-17)13-6-7-19-10-13/h2-7,9-11H,8H2,1H3 QYDUUGDHAIAMCD-UHFFFAOYSA-N 8742 1-[(4-methoxyphenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 21 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 1900 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8742 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8742&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539903 11109481 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14758 OC(=O)c1cccc(Cn2cnc(c2)-c2ccsc2)c1 InChI=1S/C15H12N2O2S/c18-15(19)12-3-1-2-11(6-12)7-17-8-14(16-10-17)13-4-5-20-9-13/h1-6,8-10H,7H2,(H,18,19) APQUMFPQSGGSDH-UHFFFAOYSA-N 8743 3-{[4-(thiophen-3-yl)-1H-imidazol-1-yl]methyl}benzoic acid::Disubstituted imidazole 22 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) >100000 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8743 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8743&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539904 11109482 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14759 Cc1ccc(Cn2cnc(c2)-c2ccsc2)cc1 InChI=1S/C15H14N2S/c1-12-2-4-13(5-3-12)8-17-9-15(16-11-17)14-6-7-18-10-14/h2-7,9-11H,8H2,1H3 DHBTWCAOUVLMCW-UHFFFAOYSA-N 8744 1-[(4-methylphenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 23 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 250 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8744 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8744&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539905 11109483 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14760 Cn1cnc(c1)-c1ccsc1 InChI=1S/C8H8N2S/c1-10-4-8(9-6-10)7-2-3-11-5-7/h2-6H,1H3 BISDRUPVBMQZBH-UHFFFAOYSA-N 8745 1-methyl-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 24 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) >100000 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8745 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8745&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539906 11109484 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14761 Cc1cccc(Cn2cnc(c2)-c2ccsc2)c1 InChI=1S/C15H14N2S/c1-12-3-2-4-13(7-12)8-17-9-15(16-11-17)14-5-6-18-10-14/h2-7,9-11H,8H2,1H3 DERBZWWOAFEQFV-UHFFFAOYSA-N 8746 1-[(3-methylphenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 25 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 4240 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8746 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8746&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539907 11109485 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14762 Cc1ccccc1Cn1cnc(c1)-c1ccsc1 InChI=1S/C15H14N2S/c1-12-4-2-3-5-13(12)8-17-9-15(16-11-17)14-6-7-18-10-14/h2-7,9-11H,8H2,1H3 RHKOAHSVPBWGJV-UHFFFAOYSA-N 8747 1-[(2-methylphenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 26 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 36500 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8747 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8747&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539908 11109486 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14763 C(c1ccc(cc1)-c1ccccc1)n1cnc(c1)-c1ccsc1 InChI=1S/C20H16N2S/c1-2-4-17(5-3-1)18-8-6-16(7-9-18)12-22-13-20(21-15-22)19-10-11-23-14-19/h1-11,13-15H,12H2 LVMVRNXVOMGHBC-UHFFFAOYSA-N 8748 1-[(4-phenylphenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 27 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 7660 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8748 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8748&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539909 11109487 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14764 COc1ccc(cc1)-c1cn(Cc2ccccc2)cn1 InChI=1S/C17H16N2O/c1-20-16-9-7-15(8-10-16)17-12-19(13-18-17)11-14-5-3-2-4-6-14/h2-10,12-13H,11H2,1H3 UJYVELWVAFQVEN-UHFFFAOYSA-N 8749 1-benzyl-4-(4-methoxyphenyl)-1H-imidazole::Disubstituted imidazole 28 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 1130 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8749 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8749&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539910 11109488 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14765 COc1ccc(cc1)-c1cn(Cc2ccc(cc2)C(F)(F)F)cn1 InChI=1S/C18H15F3N2O/c1-24-16-8-4-14(5-9-16)17-11-23(12-22-17)10-13-2-6-15(7-3-13)18(19,20)21/h2-9,11-12H,10H2,1H3 MOLDPFWVNBGONI-UHFFFAOYSA-N 8750 4-(4-methoxyphenyl)-1-{[4-(trifluoromethyl)phenyl]methyl}-1H-imidazole::Disubstituted imidazole 29 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 4070 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8750 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8750&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539911 11109489 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14766 FC(F)(F)c1ccc(cc1)-c1cn(Cc2ccccc2)cn1 InChI=1S/C17H13F3N2/c18-17(19,20)15-8-6-14(7-9-15)16-11-22(12-21-16)10-13-4-2-1-3-5-13/h1-9,11-12H,10H2 DRWRWALCWFLZQN-UHFFFAOYSA-N 8751 1-benzyl-4-[4-(trifluoromethyl)phenyl]-1H-imidazole::Disubstituted imidazole 30 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) >100000 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8751 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8751&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539912 11109490 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14767 Cc1ccc(Cn2cnc(c2)-c2cccc(Cl)c2Cl)cc1 InChI=1S/C17H14Cl2N2/c1-12-5-7-13(8-6-12)9-21-10-16(20-11-21)14-3-2-4-15(18)17(14)19/h2-8,10-11H,9H2,1H3 YNIRUERGIHZWEY-UHFFFAOYSA-N 8752 4-(2,3-dichlorophenyl)-1-[(4-methylphenyl)methyl]-1H-imidazole::Disubstituted imidazole 31 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) >10000 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8752 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8752&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539913 11109491 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14768 COc1ccc(cc1)-c1c[nH]c(Cc2ccc(C)cc2)n1 InChI=1S/C18H18N2O/c1-13-3-5-14(6-4-13)11-18-19-12-17(20-18)15-7-9-16(21-2)10-8-15/h3-10,12H,11H2,1-2H3,(H,19,20) GOGOZAKGICXBRX-UHFFFAOYSA-N 8753 5-(4-methoxyphenyl)-2-[(4-methylphenyl)methyl]-1H-imidazole::Disubstituted imidazole 11 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 66200 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8753 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8753&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539914 11109492 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14769 C([C@H]1COC(=N1)c1ccsc1)c1ccccc1 |r,c:4| InChI=1S/C14H13NOS/c1-2-4-11(5-3-1)8-13-9-16-14(15-13)12-6-7-17-10-12/h1-7,10,13H,8-9H2 HUHVJSXYULHZJW-UHFFFAOYSA-N 8754 (4S)-4-benzyl-2-(thiophen-3-yl)-4,5-dihydro-1,3-oxazole::oxazoline 15 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) >100000 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8754 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8754&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539915 11109493 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14770 Cc1ccc(Cc2coc(n2)-c2ccsc2)cc1 InChI=1S/C15H13NOS/c1-11-2-4-12(5-3-11)8-14-9-17-15(16-14)13-6-7-18-10-13/h2-7,9-10H,8H2,1H3 RGMRJWBWBGBFSO-UHFFFAOYSA-N 8755 4-[(4-methylphenyl)methyl]-2-(thiophen-3-yl)-1,3-oxazole::oxazole 16 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) >100000 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8755 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8755&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539916 11109494 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14771 Cc1ccc(Cc2noc(n2)-c2ccsc2)cc1 InChI=1S/C14H12N2OS/c1-10-2-4-11(5-3-10)8-13-15-14(17-16-13)12-6-7-18-9-12/h2-7,9H,8H2,1H3 OPCSLBQDZDQIHM-UHFFFAOYSA-N 8756 3-[(4-methylphenyl)methyl]-5-(thiophen-3-yl)-1,2,4-oxadiazole::oxadiazole 19 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 51000 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8756 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8756&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539917 11109495 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14772 C([C@@H]1COC(=N1)c1ccsc1)c1ccccc1 |r,c:4| InChI=1S/C14H13NOS/c1-2-4-11(5-3-1)8-13-9-16-14(15-13)12-6-7-17-10-12/h1-7,10,13H,8-9H2 HUHVJSXYULHZJW-UHFFFAOYSA-N 8757 (4R)-4-benzyl-2-(thiophen-3-yl)-4,5-dihydro-1,3-oxazole::oxazoline 32 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) >100000 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8757 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8757&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539918 11109496 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14773 Cc1ccc(Cc2nc(no2)-c2ccsc2)cc1 InChI=1S/C14H12N2OS/c1-10-2-4-11(5-3-10)8-13-15-14(16-17-13)12-6-7-18-9-12/h2-7,9H,8H2,1H3 VSWGLBAVZHBJDE-UHFFFAOYSA-N 8758 5-[(4-methylphenyl)methyl]-3-(thiophen-3-yl)-1,2,4-oxadiazole::oxadiazole 33 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 50700 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8758 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8758&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539919 11109497 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14774 c1cc(c(cc1Cl)O)Oc2ccc(cc2Cl)Cl InChI=1S/C12H7Cl3O2/c13-7-1-3-11(9(15)5-7)17-12-4-2-8(14)6-10(12)16/h1-6,16H XEFQLINVKFYRCS-UHFFFAOYSA-N 8726 CHEMBL849::TCL::5-chloro-2-(2,4-dichlorophenoxy)phenol::Triclosan::US20230414581, Compound 35 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI Staphylococcus aureus (strain MRSA252) 1100 6.5000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8726 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1026&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8726&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADPH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search TCL 2O2S,4M89,1UH5,4NR0,3PJF,3PJE,3PJD,6AH9,2O2Y,5YCS,1P45,3OID,3OIF,1QSG,2B35,2QIO,3P9T,3NRC,3GR6,2WYW,1NHG,5IFL,3AM3,3AM5,1D8A,1QG6,1D7O,4W9N,2PD3,1C14,7FCM,4ALL,4ALI 5564 11109466 CHEMBL849 DB08604 C12059 1 MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGFHAIK 3GR6,3GNS,4NZ9,4ALL,3GNT,6TBC,6TBB Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI FABI_STAAR Q6GI75 14775 Cc1ccc(Cn2cnc(c2)-c2cccs2)cc1 InChI=1S/C15H14N2S/c1-12-4-6-13(7-5-12)9-17-10-14(16-11-17)15-3-2-8-18-15/h2-8,10-11H,9H2,1H3 UMOFOLLUKPBVQG-UHFFFAOYSA-N 8738 1-[(4-methylphenyl)methyl]-4-(thiophen-2-yl)-1H-imidazole::Disubstituted imidazole 1 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 13700 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8738 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8738&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 446185 11109477 DB03030 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14776 COc1ccc(cc1)-c1cn(Cc2ccc(C)cc2)cn1 InChI=1S/C18H18N2O/c1-14-3-5-15(6-4-14)11-20-12-18(19-13-20)16-7-9-17(21-2)10-8-16/h3-10,12-13H,11H2,1-2H3 XAEAKTBHLFKUKT-UHFFFAOYSA-N 8739 4-(4-methoxyphenyl)-1-[(4-methylphenyl)methyl]-1H-imidazole::Disubstituted imidazole 4 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 3920 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8739 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8739&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539900 11109478 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14777 O=N(=O)c1cccc(Cn2cnc(c2)-c2ccsc2)c1 InChI=1S/C14H11N3O2S/c18-17(19)13-3-1-2-11(6-13)7-16-8-14(15-10-16)12-4-5-20-9-12/h1-6,8-10H,7H2 UNSOKCLOXGBFRH-UHFFFAOYSA-N 8740 1-[(3-nitrophenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 8 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 26900 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8740 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8740&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539901 11109479 C06058 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14778 Nc1ccc(Cn2cnc(c2)-c2ccsc2)cc1 InChI=1S/C14H13N3S/c15-13-3-1-11(2-4-13)7-17-8-14(16-10-17)12-5-6-18-9-12/h1-6,8-10H,7,15H2 LHODHAYQPAPVED-UHFFFAOYSA-N 8741 4-{[4-(thiophen-3-yl)-1H-imidazol-1-yl]methyl}aniline::Disubstituted imidazole 20 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 5140 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8741 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8741&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539902 11109480 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14779 COc1ccc(Cn2cnc(c2)-c2ccsc2)cc1 InChI=1S/C15H14N2OS/c1-18-14-4-2-12(3-5-14)8-17-9-15(16-11-17)13-6-7-19-10-13/h2-7,9-11H,8H2,1H3 QYDUUGDHAIAMCD-UHFFFAOYSA-N 8742 1-[(4-methoxyphenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 21 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 9400 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8742 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8742&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539903 11109481 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14780 OC(=O)c1cccc(Cn2cnc(c2)-c2ccsc2)c1 InChI=1S/C15H12N2O2S/c18-15(19)12-3-1-2-11(6-12)7-17-8-14(16-10-17)13-4-5-20-9-13/h1-6,8-10H,7H2,(H,18,19) APQUMFPQSGGSDH-UHFFFAOYSA-N 8743 3-{[4-(thiophen-3-yl)-1H-imidazol-1-yl]methyl}benzoic acid::Disubstituted imidazole 22 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) >100000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8743 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8743&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539904 11109482 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14781 Cc1ccc(Cn2cnc(c2)-c2ccsc2)cc1 InChI=1S/C15H14N2S/c1-12-2-4-13(5-3-12)8-17-9-15(16-11-17)14-6-7-18-10-14/h2-7,9-11H,8H2,1H3 DHBTWCAOUVLMCW-UHFFFAOYSA-N 8744 1-[(4-methylphenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 23 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 6440 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8744 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8744&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539905 11109483 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14782 Cc1cccc(Cn2cnc(c2)-c2ccsc2)c1 InChI=1S/C15H14N2S/c1-12-3-2-4-13(7-12)8-17-9-15(16-11-17)14-5-6-18-10-14/h2-7,9-11H,8H2,1H3 DERBZWWOAFEQFV-UHFFFAOYSA-N 8746 1-[(3-methylphenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 25 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 12200 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8746 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8746&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539907 11109485 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14783 Cc1ccccc1Cn1cnc(c1)-c1ccsc1 InChI=1S/C15H14N2S/c1-12-4-2-3-5-13(12)8-17-9-15(16-11-17)14-6-7-18-10-14/h2-7,9-11H,8H2,1H3 RHKOAHSVPBWGJV-UHFFFAOYSA-N 8747 1-[(2-methylphenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 26 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 65400 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8747 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8747&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539908 11109486 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14784 C(c1ccc(cc1)-c1ccccc1)n1cnc(c1)-c1ccsc1 InChI=1S/C20H16N2S/c1-2-4-17(5-3-1)18-8-6-16(7-9-18)12-22-13-20(21-15-22)19-10-11-23-14-19/h1-11,13-15H,12H2 LVMVRNXVOMGHBC-UHFFFAOYSA-N 8748 1-[(4-phenylphenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole::Disubstituted imidazole 27 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 1180 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8748 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8748&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539909 11109487 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14785 COc1ccc(cc1)-c1cn(Cc2ccccc2)cn1 InChI=1S/C17H16N2O/c1-20-16-9-7-15(8-10-16)17-12-19(13-18-17)11-14-5-3-2-4-6-14/h2-10,12-13H,11H2,1H3 UJYVELWVAFQVEN-UHFFFAOYSA-N 8749 1-benzyl-4-(4-methoxyphenyl)-1H-imidazole::Disubstituted imidazole 28 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 5280 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8749 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8749&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539910 11109488 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14786 COc1ccc(cc1)-c1cn(Cc2ccc(cc2)C(F)(F)F)cn1 InChI=1S/C18H15F3N2O/c1-24-16-8-4-14(5-9-16)17-11-23(12-22-17)10-13-2-6-15(7-3-13)18(19,20)21/h2-9,11-12H,10H2,1H3 MOLDPFWVNBGONI-UHFFFAOYSA-N 8750 4-(4-methoxyphenyl)-1-{[4-(trifluoromethyl)phenyl]methyl}-1H-imidazole::Disubstituted imidazole 29 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 28300 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8750 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8750&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539911 11109489 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14787 COc1ccc(cc1)-c1c[nH]c(Cc2ccc(C)cc2)n1 InChI=1S/C18H18N2O/c1-13-3-5-14(6-4-13)11-18-19-12-17(20-18)15-7-9-16(21-2)10-8-15/h3-10,12H,11H2,1-2H3,(H,19,20) GOGOZAKGICXBRX-UHFFFAOYSA-N 8753 5-(4-methoxyphenyl)-2-[(4-methylphenyl)methyl]-1H-imidazole::Disubstituted imidazole 11 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) >100000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8753 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8753&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539914 11109492 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14788 C([C@H]1COC(=N1)c1ccsc1)c1ccccc1 |r,c:4| InChI=1S/C14H13NOS/c1-2-4-11(5-3-1)8-13-9-16-14(15-13)12-6-7-17-10-12/h1-7,10,13H,8-9H2 HUHVJSXYULHZJW-UHFFFAOYSA-N 8754 (4S)-4-benzyl-2-(thiophen-3-yl)-4,5-dihydro-1,3-oxazole::oxazoline 15 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) >100000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8754 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8754&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539915 11109493 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14789 Cc1ccc(Cc2coc(n2)-c2ccsc2)cc1 InChI=1S/C15H13NOS/c1-11-2-4-12(5-3-11)8-14-9-17-15(16-14)13-6-7-18-10-13/h2-7,9-10H,8H2,1H3 RGMRJWBWBGBFSO-UHFFFAOYSA-N 8755 4-[(4-methylphenyl)methyl]-2-(thiophen-3-yl)-1,3-oxazole::oxazole 16 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) >100000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8755 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8755&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539916 11109494 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14790 Cc1ccc(Cc2noc(n2)-c2ccsc2)cc1 InChI=1S/C14H12N2OS/c1-10-2-4-11(5-3-10)8-13-15-14(17-16-13)12-6-7-18-9-12/h2-7,9H,8H2,1H3 OPCSLBQDZDQIHM-UHFFFAOYSA-N 8756 3-[(4-methylphenyl)methyl]-5-(thiophen-3-yl)-1,2,4-oxadiazole::oxadiazole 19 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) >100000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8756 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8756&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539917 11109495 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14791 C([C@@H]1COC(=N1)c1ccsc1)c1ccccc1 |r,c:4| InChI=1S/C14H13NOS/c1-2-4-11(5-3-1)8-13-9-16-14(15-13)12-6-7-17-10-12/h1-7,10,13H,8-9H2 HUHVJSXYULHZJW-UHFFFAOYSA-N 8757 (4R)-4-benzyl-2-(thiophen-3-yl)-4,5-dihydro-1,3-oxazole::oxazoline 32 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) >100000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8757 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8757&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539918 11109496 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14792 Cc1ccc(Cc2nc(no2)-c2ccsc2)cc1 InChI=1S/C14H12N2OS/c1-10-2-4-11(5-3-10)8-13-15-14(16-17-13)12-6-7-18-9-12/h2-7,9H,8H2,1H3 VSWGLBAVZHBJDE-UHFFFAOYSA-N 8758 5-[(4-methylphenyl)methyl]-3-(thiophen-3-yl)-1,2,4-oxadiazole::oxadiazole 33 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) >100000 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8758 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8758&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search 6539919 11109497 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132 14793 c1cc(c(cc1Cl)O)Oc2ccc(cc2Cl)Cl InChI=1S/C12H7Cl3O2/c13-7-1-3-11(9(15)5-7)17-12-4-2-8(14)6-10(12)16/h1-6,16H XEFQLINVKFYRCS-UHFFFAOYSA-N 8726 CHEMBL849::TCL::5-chloro-2-(2,4-dichlorophenoxy)phenol::Triclosan::US20230414581, Compound 35 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI Escherichia coli (strain K12) 430 30.00 C Curated from the literature by BindingDB 10.1016/s0960-894x(01)00404-8 10.7270/Q28P5XQG 11514139 aid1796223 Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 8/20/2001 4/17/2006 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=8726 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1028&target=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=8726&enzyme=Enoyl-%5Bacyl-carrier-protein%5D+reductase+%5BNADH%5D+FabI&column=ki&startPg=0&Increment=50&submit=Search TCL 2O2S,4M89,1UH5,4NR0,3PJF,3PJE,3PJD,6AH9,2O2Y,5YCS,1P45,3OID,3OIF,1QSG,2B35,2QIO,3P9T,3NRC,3GR6,2WYW,1NHG,5IFL,3AM3,3AM5,1D8A,1QG6,1D7O,4W9N,2PD3,1C14,7FCM,4ALL,4ALI 5564 11109466 CHEMBL849 DB08604 C12059 1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK 4JX8,4JQC,4D46,4CV3,4CV2,2FHS,1QSG,1MFP,1LXC,1LX6,1I30,1I2Z,1C14,7UMW,7UM8,5CG2,5CG1,5CFZ,1QG6,1DFI,1DFH,1DFG,1D8A Enoyl-[acyl-carrier-protein] reductase [NADH] FabI FABI_ECOLI P0AEK4 P29132