BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50178196 CC(=O)Nc1ccc(CCCCNCCc2c([nH]c3ccccc23)-c2cc(C)cc(C)c2)cn1 InChI=1S/C29H34N4O/c1-20-16-21(2)18-24(17-20)29-26(25-9-4-5-10-27(25)33-29)13-15-30-14-7-6-8-23-11-12-28(31-19-23)32-22(3)34/h4-5,9-12,16-19,30,33H,6-8,13-15H2,1-3H3,(H,31,32,34) LOKNCKTZVGYNJF-UHFFFAOYSA-N 50099030 N-[5-(4-{2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethylamino}-butyl)-pyridin-2-yl]-acetamide::CHEMBL11263 Gonadotropin-releasing hormone receptor Rattus norvegicus 120 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099030 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099030&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267232 103995961 CHEMBL11263 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178197 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1ccc(O)cc1 InChI=1S/C28H32N2O/c1-20-17-21(2)19-23(18-20)28-26(25-8-3-4-9-27(25)30-28)14-16-29-15-6-5-7-22-10-12-24(31)13-11-22/h3-4,8-13,17-19,29-31H,5-7,14-16H2,1-2H3 PACZUAOKBGMJAN-UHFFFAOYSA-N 50097007 4-(4-{2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethylamino}-butyl)-phenol::CHEMBL10931 Gonadotropin-releasing hormone receptor Rattus norvegicus 27 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50097007 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50097007&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 9979079 103994409 CHEMBL10931 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178198 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCc1ccccn1 InChI=1S/C24H25N3/c1-17-13-18(2)15-19(14-17)24-22(21-8-3-4-9-23(21)27-24)10-12-25-16-20-7-5-6-11-26-20/h3-9,11,13-15,25,27H,10,12,16H2,1-2H3 NXIAWTVLJBAKEC-UHFFFAOYSA-N 50099031 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-pyridin-2-ylmethyl-amine::CHEMBL274441 Gonadotropin-releasing hormone receptor Rattus norvegicus >10000 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099031 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099031&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267241 103995962 CHEMBL274441 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178199 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1cccnc1 InChI=1S/C27H31N3/c1-20-16-21(2)18-23(17-20)27-25(24-10-3-4-11-26(24)30-27)12-15-28-13-6-5-8-22-9-7-14-29-19-22/h3-4,7,9-11,14,16-19,28,30H,5-6,8,12-13,15H2,1-2H3 NBPQAGQRDUHMOK-UHFFFAOYSA-N 50099033 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(4-pyridin-3-yl-butyl)-amine::CHEMBL262715 Gonadotropin-releasing hormone receptor Rattus norvegicus 40 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099033&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267238 103995964 CHEMBL262715 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178200 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCc1cccnc1 InChI=1S/C26H29N3/c1-19-15-20(2)17-22(16-19)26-24(23-9-3-4-10-25(23)29-26)11-14-27-12-5-7-21-8-6-13-28-18-21/h3-4,6,8-10,13,15-18,27,29H,5,7,11-12,14H2,1-2H3 PZIHYHXZUWIIGM-UHFFFAOYSA-N 50099034 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(3-pyridin-3-yl-propyl)-amine::CHEMBL11021 Gonadotropin-releasing hormone receptor Rattus norvegicus 200 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099034 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099034&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267250 103995965 CHEMBL11021 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178201 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1ccc(O)cc1 InChI=1S/C28H32N2O/c1-20-17-21(2)19-23(18-20)28-26(25-8-3-4-9-27(25)30-28)14-16-29-15-6-5-7-22-10-12-24(31)13-11-22/h3-4,8-13,17-19,29-31H,5-7,14-16H2,1-2H3 PACZUAOKBGMJAN-UHFFFAOYSA-N 50097007 4-(4-{2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethylamino}-butyl)-phenol::CHEMBL10931 Gonadotropin-releasing hormone receptor Homo sapiens 357.0 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50097007 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50097007&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 9979079 103994409 CHEMBL10931 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50178202 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCc1ccncc1 InChI=1S/C26H29N3/c1-19-16-20(2)18-22(17-19)26-24(23-7-3-4-8-25(23)29-26)11-15-27-12-5-6-21-9-13-28-14-10-21/h3-4,7-10,13-14,16-18,27,29H,5-6,11-12,15H2,1-2H3 OHAMWRNBILTWPI-UHFFFAOYSA-N 50099032 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(3-pyridin-4-yl-propyl)-amine::CHEMBL273725 Gonadotropin-releasing hormone receptor Rattus norvegicus 210 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099032 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099032&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267255 103995963 CHEMBL273725 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178203 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCc1ccccn1 InChI=1S/C25H27N3/c1-18-15-19(2)17-20(16-18)25-23(22-8-3-4-9-24(22)28-25)11-14-26-13-10-21-7-5-6-12-27-21/h3-9,12,15-17,26,28H,10-11,13-14H2,1-2H3 MXCVIXZLRNCGTM-UHFFFAOYSA-N 50099035 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(2-pyridin-2-yl-ethyl)-amine::CHEMBL269636 Gonadotropin-releasing hormone receptor Rattus norvegicus 2170 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099035 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099035&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267258 103995966 CHEMBL269636 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178204 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1ccc(NS(C)(=O)=O)cc1 InChI=1S/C29H35N3O2S/c1-21-18-22(2)20-24(19-21)29-27(26-9-4-5-10-28(26)31-29)15-17-30-16-7-6-8-23-11-13-25(14-12-23)32-35(3,33)34/h4-5,9-14,18-20,30-32H,6-8,15-17H2,1-3H3 RRLFSIAYEBCALH-UHFFFAOYSA-N 50099023 N-[4-(4-{2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethylamino}-butyl)-phenyl]-methanesulfonamide::N-[4-(4-{2-[2-(3,5-Dimethyl-phenyl)-2,3-dihydro-1H-indol-3-yl]-ethylamino}-butyl)-phenyl]-methanesulfonamide::CHEMBL11149 Gonadotropin-releasing hormone receptor Rattus norvegicus 7 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099023 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099023&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 10074296 103995954 CHEMBL11149 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178205 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1ccc(NS(C)(=O)=O)cc1 InChI=1S/C29H35N3O2S/c1-21-18-22(2)20-24(19-21)29-27(26-9-4-5-10-28(26)31-29)15-17-30-16-7-6-8-23-11-13-25(14-12-23)32-35(3,33)34/h4-5,9-14,18-20,30-32H,6-8,15-17H2,1-3H3 RRLFSIAYEBCALH-UHFFFAOYSA-N 50099023 N-[4-(4-{2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethylamino}-butyl)-phenyl]-methanesulfonamide::N-[4-(4-{2-[2-(3,5-Dimethyl-phenyl)-2,3-dihydro-1H-indol-3-yl]-ethylamino}-butyl)-phenyl]-methanesulfonamide::CHEMBL11149 Gonadotropin-releasing hormone receptor Homo sapiens 170 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099023 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7224&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099023&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 10074296 103995954 CHEMBL11149 1 MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_HUMAN P30968 O75793 Q14D13 Q92644 50178206 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1ccncc1 InChI=1S/C27H31N3/c1-20-17-21(2)19-23(18-20)27-25(24-8-3-4-9-26(24)30-27)12-16-28-13-6-5-7-22-10-14-29-15-11-22/h3-4,8-11,14-15,17-19,28,30H,5-7,12-13,16H2,1-2H3 DTLBVHBEDJEATA-UHFFFAOYSA-N 50099036 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(4-pyridin-4-yl-butyl)-amine::CHEMBL11009 Gonadotropin-releasing hormone receptor Rattus norvegicus 16 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099036 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099036&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 10046374 103995967 CHEMBL11009 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178207 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1cncnc1 InChI=1S/C26H30N4/c1-19-13-20(2)15-22(14-19)26-24(23-8-3-4-9-25(23)30-26)10-12-27-11-6-5-7-21-16-28-18-29-17-21/h3-4,8-9,13-18,27,30H,5-7,10-12H2,1-2H3 TVQQNCRVZXKJGM-UHFFFAOYSA-N 50099037 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(4-pyrimidin-5-yl-butyl)-amine::CHEMBL275920 Gonadotropin-releasing hormone receptor Rattus norvegicus 270 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099037 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099037&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267251 103995968 CHEMBL275920 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178208 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1ccccn1 InChI=1S/C27H31N3/c1-20-17-21(2)19-22(18-20)27-25(24-11-3-4-12-26(24)30-27)13-16-28-14-7-5-9-23-10-6-8-15-29-23/h3-4,6,8,10-12,15,17-19,28,30H,5,7,9,13-14,16H2,1-2H3 BJPVKNQYVPSWPH-UHFFFAOYSA-N 50099039 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(4-pyridin-2-yl-butyl)-amine::CHEMBL11087 Gonadotropin-releasing hormone receptor Rattus norvegicus 450 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099039 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099039&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267254 103995970 CHEMBL11087 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178209 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1ccc2CCCCc2c1 InChI=1S/C32H38N2/c1-23-19-24(2)21-28(20-23)32-30(29-12-5-6-13-31(29)34-32)16-18-33-17-8-7-9-25-14-15-26-10-3-4-11-27(26)22-25/h5-6,12-15,19-22,33-34H,3-4,7-11,16-18H2,1-2H3 NIIMDBNVVZXSMG-UHFFFAOYSA-N 50099038 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-[4-(5,6,7,8-tetrahydro-naphthalen-2-yl)-butyl]-amine::CHEMBL11623 Gonadotropin-releasing hormone receptor Rattus norvegicus 1260 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099038 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099038&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267270 103995969 CHEMBL11623 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178210 COc1ccc(CCCCNCCc2c([nH]c3ccccc23)-c2cc(C)cc(C)c2)cn1 InChI=1S/C28H33N3O/c1-20-16-21(2)18-23(17-20)28-25(24-9-4-5-10-26(24)31-28)13-15-29-14-7-6-8-22-11-12-27(32-3)30-19-22/h4-5,9-12,16-19,29,31H,6-8,13-15H2,1-3H3 QQLQYQXMBHRCMP-UHFFFAOYSA-N 50099040 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-[4-(6-methoxy-pyridin-3-yl)-butyl]-amine::CHEMBL11310 Gonadotropin-releasing hormone receptor Rattus norvegicus 90 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099040 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099040&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267240 103995971 CHEMBL11310 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178211 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCc1ccncc1 InChI=1S/C25H27N3/c1-18-15-19(2)17-21(16-18)25-23(22-5-3-4-6-24(22)28-25)10-14-27-13-9-20-7-11-26-12-8-20/h3-8,11-12,15-17,27-28H,9-10,13-14H2,1-2H3 FGEXGANWPSRWHR-UHFFFAOYSA-N 50099042 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(2-pyridin-4-yl-ethyl)-amine::CHEMBL275287 Gonadotropin-releasing hormone receptor Rattus norvegicus 160 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099042 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099042&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267237 103995973 CHEMBL275287 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178212 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1cnc[nH]1 InChI=1S/C25H30N4/c1-18-13-19(2)15-20(14-18)25-23(22-8-3-4-9-24(22)29-25)10-12-26-11-6-5-7-21-16-27-17-28-21/h3-4,8-9,13-17,26,29H,5-7,10-12H2,1-2H3,(H,27,28) KDAKNVSAWJEPOL-UHFFFAOYSA-N 50099044 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-[4-(1H-imidazol-4-yl)-butyl]-amine::CHEMBL11375 Gonadotropin-releasing hormone receptor Rattus norvegicus 450 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099044 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099044&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267271 103995975 CHEMBL11375 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178213 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCCc1cccnc1 InChI=1S/C28H33N3/c1-21-17-22(2)19-24(18-21)28-26(25-11-5-6-12-27(25)31-28)13-16-29-14-7-3-4-9-23-10-8-15-30-20-23/h5-6,8,10-12,15,17-20,29,31H,3-4,7,9,13-14,16H2,1-2H3 QNSRLZXZYNSAFH-UHFFFAOYSA-N 50099043 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(5-pyridin-3-yl-pentyl)-amine::CHEMBL11253 Gonadotropin-releasing hormone receptor Rattus norvegicus 50 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099043 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099043&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267231 103995974 CHEMBL11253 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178214 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1ccc(NS(C)(=O)=O)nc1 InChI=1S/C28H34N4O2S/c1-20-16-21(2)18-23(17-20)28-25(24-9-4-5-10-26(24)31-28)13-15-29-14-7-6-8-22-11-12-27(30-19-22)32-35(3,33)34/h4-5,9-12,16-19,29,31H,6-8,13-15H2,1-3H3,(H,30,32) CXEVXATYJRKMGM-UHFFFAOYSA-N 50099045 N-[5-(4-{2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethylamino}-butyl)-pyridin-2-yl]-methanesulfonamide::CHEMBL273625 Gonadotropin-releasing hormone receptor Rattus norvegicus 45 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099045 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099045&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267275 103995976 CHEMBL273625 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178215 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1cnc2ccccc2c1 InChI=1S/C31H33N3/c1-22-17-23(2)19-26(18-22)31-28(27-11-4-6-13-30(27)34-31)14-16-32-15-8-7-9-24-20-25-10-3-5-12-29(25)33-21-24/h3-6,10-13,17-21,32,34H,7-9,14-16H2,1-2H3 DOMKDOIDAOTVHL-UHFFFAOYSA-N 50099041 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(4-quinolin-3-yl-butyl)-amine::CHEMBL11014 Gonadotropin-releasing hormone receptor Rattus norvegicus 36 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099041 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099041&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267256 103995972 CHEMBL11014 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178216 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1ccc(=O)[nH]c1 InChI=1S/C27H31N3O/c1-19-15-20(2)17-22(16-19)27-24(23-8-3-4-9-25(23)30-27)12-14-28-13-6-5-7-21-10-11-26(31)29-18-21/h3-4,8-11,15-18,28,30H,5-7,12-14H2,1-2H3,(H,29,31) GGBBWBAOUOFWPM-UHFFFAOYSA-N 50099046 5-(4-{2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethylamino}-butyl)-1H-pyridin-2-one::CHEMBL267558 Gonadotropin-releasing hormone receptor Rattus norvegicus 57 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099046 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099046&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267239 103995977 CHEMBL267558 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178217 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCc1cccnc1 InChI=1S/C24H25N3/c1-17-12-18(2)14-20(13-17)24-22(21-7-3-4-8-23(21)27-24)9-11-26-16-19-6-5-10-25-15-19/h3-8,10,12-15,26-27H,9,11,16H2,1-2H3 PRAFMPSNKSFDCZ-UHFFFAOYSA-N 50099047 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-pyridin-3-ylmethyl-amine::CHEMBL11523 Gonadotropin-releasing hormone receptor Rattus norvegicus 4500 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099047 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099047&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267242 103995978 CHEMBL11523 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178218 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCc1cccnc1 InChI=1S/C25H27N3/c1-18-14-19(2)16-21(15-18)25-23(22-7-3-4-8-24(22)28-25)10-13-26-12-9-20-6-5-11-27-17-20/h3-8,11,14-17,26,28H,9-10,12-13H2,1-2H3 KCQWRXMFOBGTFO-UHFFFAOYSA-N 50099048 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(2-pyridin-3-yl-ethyl)-amine::CHEMBL11436 Gonadotropin-releasing hormone receptor Rattus norvegicus 200 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099048 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099048&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267233 103995979 CHEMBL11436 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178219 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCCc1ccncc1 InChI=1S/C28H33N3/c1-21-18-22(2)20-24(19-21)28-26(25-9-5-6-10-27(25)31-28)13-17-29-14-7-3-4-8-23-11-15-30-16-12-23/h5-6,9-12,15-16,18-20,29,31H,3-4,7-8,13-14,17H2,1-2H3 XGPUBBBQAZIQJY-UHFFFAOYSA-N 50099050 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-(5-pyridin-4-yl-pentyl)-amine::CHEMBL11420 Gonadotropin-releasing hormone receptor Rattus norvegicus 150 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099050 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099050&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 9909560 103995981 CHEMBL11420 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178220 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCc1ccncc1 InChI=1S/C24H25N3/c1-17-13-18(2)15-20(14-17)24-22(21-5-3-4-6-23(21)27-24)9-12-26-16-19-7-10-25-11-8-19/h3-8,10-11,13-15,26-27H,9,12,16H2,1-2H3 AFOLPDIPZANTOF-UHFFFAOYSA-N 50099049 {2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethyl}-pyridin-4-ylmethyl-amine::CHEMBL11134 Gonadotropin-releasing hormone receptor Rattus norvegicus 9000 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099049 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099049&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267257 103995980 CHEMBL11134 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969 50178221 Cc1cc(C)cc(c1)-c1[nH]c2ccccc2c1CCNCCCCc1ccc(N)nc1 InChI=1S/C27H32N4/c1-19-15-20(2)17-22(16-19)27-24(23-8-3-4-9-25(23)31-27)12-14-29-13-6-5-7-21-10-11-26(28)30-18-21/h3-4,8-11,15-18,29,31H,5-7,12-14H2,1-2H3,(H2,28,30) ZTLKUZYVVJAIRP-UHFFFAOYSA-N 50099051 5-(4-{2-[2-(3,5-Dimethyl-phenyl)-1H-indol-3-yl]-ethylamino}-butyl)-pyridin-2-ylamine::CHEMBL11101 Gonadotropin-releasing hormone receptor Rattus norvegicus 41 ChEMBL 10.1016/s0960-894x(01)00133-0 10.7270/Q2J102FK 11327594 Lin, P; Parikh, M; Lo, JL; Yang, YT; Cheng, K; Smith, RG; Fisher, MH; Wyvratt, MJ; Goulet, MT 4/30/2001 11/10/2009 Merck Research Laboratories http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50099051 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000517&target=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50099051&enzyme=Gonadotropin-releasing+hormone+receptor&column=ki&startPg=0&Increment=50&submit=Search 44267278 103995982 CHEMBL11101 1 MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKLQRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRMIYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRVLHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL Gonadotropin-releasing hormone receptor GNRHR_RAT P30969