BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50167348 CC(=C)COc1nc(N)nc2nc[nH]c12 InChI=1S/C9H11N5O/c1-5(2)3-15-8-6-7(12-4-11-6)13-9(10)14-8/h4H,1,3H2,2H3,(H3,10,11,12,13,14) SKVCEFNZQMPWEN-UHFFFAOYSA-N 5476 6-[(2-methylprop-2-en-1-yl)oxy]-9H-purin-2-amine::CHEMBL407876::O6-Substituted Guanine Deriv. 16 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 25000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5476 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5476&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329503 8035095 CHEMBL407876 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167349 CC(=O)COc1nc(N)nc2nc[nH]c12 InChI=1S/C8H9N5O2/c1-4(14)2-15-7-5-6(11-3-10-5)12-8(9)13-7/h3H,2H2,1H3,(H3,9,10,11,12,13) ULKWQUUOAFOEII-UHFFFAOYSA-N 5481 CHEMBL272689::1-[(2-amino-9H-purin-6-yl)oxy]propan-2-one::O6-Substituted Guanine Deriv. 21 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 95000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5481&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329508 8035100 CHEMBL272689 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167350 CCC(COc1nc(N)nc2nc[nH]c12)(OC)OC InChI=1S/C11H17N5O3/c1-4-11(17-2,18-3)5-19-9-7-8(14-6-13-7)15-10(12)16-9/h6H,4-5H2,1-3H3,(H3,12,13,14,15,16) MPBVBIVNCLMTGQ-UHFFFAOYSA-N 5502 6-(2,2-dimethoxybutoxy)-9H-purin-2-amine::CHEMBL405197::O6-Substituted Guanine Deriv. 42 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5502 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5502&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329526 8035121 CHEMBL405197 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167351 Nc1nc(OCc2ccccc2)c2[nH]cnc2n1 InChI=1S/C12H11N5O/c13-12-16-10-9(14-7-15-10)11(17-12)18-6-8-4-2-1-3-5-8/h1-5,7H,6H2,(H3,13,14,15,16,17) KRWMERLEINMZFT-UHFFFAOYSA-N 5491 6-(benzyloxy)-9H-purin-2-amine::CHEMBL407874::O6-Substituted Guanine Deriv. 31 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 180 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5491 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5491&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 4578 8035110 CHEMBL407874 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167352 CCC(=O)COc1nc(N)nc2nc[nH]c12 InChI=1S/C9H11N5O2/c1-2-5(15)3-16-8-6-7(12-4-11-6)13-9(10)14-8/h4H,2-3H2,1H3,(H3,10,11,12,13,14) HKHVWPUUQMFZGF-UHFFFAOYSA-N 50093325 1-(2-Amino-9H-purin-6-yloxy)-butan-2-one::CHEMBL337713 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 94500.0 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50093325 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50093325&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10632766 103991322 CHEMBL337713 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167353 Nc1nc(OCC#C)c2[nH]cnc2n1 InChI=1S/C8H7N5O/c1-2-3-14-7-5-6(11-4-10-5)12-8(9)13-7/h1,4H,3H2,(H3,9,10,11,12,13) MVZMHAXNJPJZIS-UHFFFAOYSA-N 5472 6-(prop-2-yn-1-yloxy)-9H-purin-2-amine::CHEMBL270483::O6-Substituted Guanine Deriv. 12 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 11500 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5472 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5472&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329500 8035091 CHEMBL270483 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167354 Nc1nc(OCC2=CCC2)c2[nH]cnc2n1 |t:6| InChI=1S/C10H11N5O/c11-10-14-8-7(12-5-13-8)9(15-10)16-4-6-2-1-3-6/h2,5H,1,3-4H2,(H3,11,12,13,14,15) UIGGIZYAKZTJSV-UHFFFAOYSA-N 50093328 6-(Cyclobut-1-enylmethoxy)-9H-purin-2-ylamine::CHEMBL439608 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 550 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50093328 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50093328&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10536741 103991323 CHEMBL439608 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167355 Nc1nc(OCc2ccccc2)c2[nH]cnc2n1 InChI=1S/C12H11N5O/c13-12-16-10-9(14-7-15-10)11(17-12)18-6-8-4-2-1-3-5-8/h1-5,7H,6H2,(H3,13,14,15,16,17) KRWMERLEINMZFT-UHFFFAOYSA-N 5491 6-(benzyloxy)-9H-purin-2-amine::CHEMBL407874::O6-Substituted Guanine Deriv. 31 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 58 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5491 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5491&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 4578 8035110 CHEMBL407874 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167356 COc1nc(N)nc2nc[nH]c12 InChI=1S/C6H7N5O/c1-12-5-3-4(9-2-8-3)10-6(7)11-5/h2H,1H3,(H3,7,8,9,10,11) BXJHWYVXLGLDMZ-UHFFFAOYSA-N 5470 CHEMBL226395::6-methoxy-9H-purin-2-amine::O6-Substituted Guanine Deriv. 1 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 248000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5470 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5470&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 65275 8035089 CHEMBL226395 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167357 Nc1nc(OCCc2ccccc2)c2[nH]cnc2n1 InChI=1S/C13H13N5O/c14-13-17-11-10(15-8-16-11)12(18-13)19-7-6-9-4-2-1-3-5-9/h1-5,8H,6-7H2,(H3,14,15,16,17,18) RSRMQDAEYHBPNN-UHFFFAOYSA-N 5496 CHEMBL446625::6-(2-phenylethoxy)-9H-purin-2-amine::O6-Substituted Guanine Deriv. 36 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 548000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5496 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5496&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329520 8035115 CHEMBL446625 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167358 Nc1nc(OCC(=O)c2ccccc2)c2[nH]cnc2n1 InChI=1S/C13H11N5O2/c14-13-17-11-10(15-7-16-11)12(18-13)20-6-9(19)8-4-2-1-3-5-8/h1-5,7H,6H2,(H3,14,15,16,17,18) VJBRKLUZBMBKHC-UHFFFAOYSA-N 50093331 2-(2-Amino-9H-purin-6-yloxy)-1-phenyl-ethanone::CHEMBL338717 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50093331 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50093331&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10659580 103991324 CHEMBL338717 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167359 Nc1nc(OCC(=C)c2ccccc2)c2[nH]cnc2n1 InChI=1S/C14H13N5O/c1-9(10-5-3-2-4-6-10)7-20-13-11-12(17-8-16-11)18-14(15)19-13/h2-6,8H,1,7H2,(H3,15,16,17,18,19) AMVHOPCPUFSVFC-UHFFFAOYSA-N 5479 CHEMBL334050::6-[(2-phenylprop-2-en-1-yl)oxy]-9H-purin-2-amine::O6-Substituted Guanine Deriv. 19 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 39600 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5479 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5479&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329506 8035098 CHEMBL334050 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167360 CCCCCCCOc1nc(N)nc2nc[nH]c12 InChI=1S/C12H19N5O/c1-2-3-4-5-6-7-18-11-9-10(15-8-14-9)16-12(13)17-11/h8H,2-7H2,1H3,(H3,13,14,15,16,17) LHMKLJDQVMCLIP-UHFFFAOYSA-N 5464 CHEMBL270945::6-(heptyloxy)-9H-purin-2-amine::O6-Substituted Guanine Deriv. 6 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >100000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5464 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5464&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329495 8035083 CHEMBL270945 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167361 Nc1nc(OCC2=CCCC2)c2[nH]cnc2n1 |t:6| InChI=1S/C11H13N5O/c12-11-15-9-8(13-6-14-9)10(16-11)17-5-7-3-1-2-4-7/h3,6H,1-2,4-5H2,(H3,12,13,14,15,16) BSCBVJDZICZHJY-UHFFFAOYSA-N 5484 6-(cyclopent-1-en-1-ylmethoxy)-9H-purin-2-amine::CHEMBL405259::O6-Substituted Guanine Deriv. 24 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 200 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5484 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5484&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329510 8035103 CHEMBL405259 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167362 Nc1nc(OCC=C)c2[nH]cnc2n1 InChI=1S/C8H9N5O/c1-2-3-14-7-5-6(11-4-10-5)12-8(9)13-7/h2,4H,1,3H2,(H3,9,10,11,12,13) HJMGFQNIHIHSCQ-UHFFFAOYSA-N 5475 CHEMBL325053::6-(prop-2-en-1-yloxy)-9H-purin-2-amine::O6-Substituted Guanine Deriv. 15 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 8500 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5475 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5475&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 179571 8035094 CHEMBL325053 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167363 Nc1nc(Oc2cccs2)c2[nH]cnc2n1 InChI=1S/C9H7N5OS/c10-9-13-7-6(11-4-12-7)8(14-9)15-5-2-1-3-16-5/h1-4H,(H3,10,11,12,13,14) UWAZXKHIDSIRNU-UHFFFAOYSA-N 50093336 6-(Thiophen-2-yloxy)-9H-purin-2-ylamine::CHEMBL337677 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 3 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50093336 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50093336&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44353224 103991326 CHEMBL337677 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167364 CC(=O)COc1nc(N)nc2nc[nH]c12 InChI=1S/C8H9N5O2/c1-4(14)2-15-7-5-6(11-3-10-5)12-8(9)13-7/h3H,2H2,1H3,(H3,9,10,11,12,13) ULKWQUUOAFOEII-UHFFFAOYSA-N 5481 CHEMBL272689::1-[(2-amino-9H-purin-6-yl)oxy]propan-2-one::O6-Substituted Guanine Deriv. 21 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 95000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5481&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329508 8035100 CHEMBL272689 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167365 Nc1nc(OCC2CCCC2)c2[nH]cnc2n1 InChI=1S/C11H15N5O/c12-11-15-9-8(13-6-14-9)10(16-11)17-5-7-3-1-2-4-7/h6-7H,1-5H2,(H3,12,13,14,15,16) VKTULUQFIRFTDC-UHFFFAOYSA-N 5483 6-(cyclopentylmethoxy)-9H-purin-2-amine::CHEMBL271593::O6-Substituted Guanine Deriv. 23 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5483 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5483&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329509 8035102 CHEMBL271593 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167366 Nc1nc(OCC=C)c2[nH]cnc2n1 InChI=1S/C8H9N5O/c1-2-3-14-7-5-6(11-4-10-5)12-8(9)13-7/h2,4H,1,3H2,(H3,9,10,11,12,13) HJMGFQNIHIHSCQ-UHFFFAOYSA-N 5475 CHEMBL325053::6-(prop-2-en-1-yloxy)-9H-purin-2-amine::O6-Substituted Guanine Deriv. 15 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 2700 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5475 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5475&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 179571 8035094 CHEMBL325053 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167367 Nc1nc(OCC=C)c2[nH]cnc2n1 InChI=1S/C8H9N5O/c1-2-3-14-7-5-6(11-4-10-5)12-8(9)13-7/h2,4H,1,3H2,(H3,9,10,11,12,13) HJMGFQNIHIHSCQ-UHFFFAOYSA-N 5475 CHEMBL325053::6-(prop-2-en-1-yloxy)-9H-purin-2-amine::O6-Substituted Guanine Deriv. 15 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 5100 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5475 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5475&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 179571 8035094 CHEMBL325053 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167368 CCOc1nc(N)nc2nc[nH]c12 InChI=1S/C7H9N5O/c1-2-13-6-4-5(10-3-9-4)11-7(8)12-6/h3H,2H2,1H3,(H3,8,9,10,11,12) SFXXRVSPZSOREJ-UHFFFAOYSA-N 5471 6-ethoxy-9H-purin-2-amine::CHEMBL406419::O6-Substituted Guanine Deriv. 2 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5471 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5471&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 95805 8035090 CHEMBL406419 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167369 COc1nc(N)nc2nc[nH]c12 InChI=1S/C6H7N5O/c1-12-5-3-4(9-2-8-3)10-6(7)11-5/h2H,1H3,(H3,7,8,9,10,11) BXJHWYVXLGLDMZ-UHFFFAOYSA-N 5470 CHEMBL226395::6-methoxy-9H-purin-2-amine::O6-Substituted Guanine Deriv. 1 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 428000.0 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5470 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5470&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 65275 8035089 CHEMBL226395 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167370 Nc1nc(OCC2=CCCCC2)c2[nH]cnc2n1 |t:6| InChI=1S/C12H15N5O/c13-12-16-10-9(14-7-15-10)11(17-12)18-6-8-4-2-1-3-5-8/h4,7H,1-3,5-6H2,(H3,13,14,15,16,17) PYEAHVHUBKALOZ-UHFFFAOYSA-N 5486 6-(cyclohex-1-en-1-ylmethoxy)-9H-purin-2-amine::CHEMBL429409::O6-Substituted Guanine Deriv. 26 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 1600 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5486 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5486&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329511 8035105 CHEMBL429409 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167371 CC(=O)COc1nc(N)nc2nc[nH]c12 InChI=1S/C8H9N5O2/c1-4(14)2-15-7-5-6(11-3-10-5)12-8(9)13-7/h3H,2H2,1H3,(H3,9,10,11,12,13) ULKWQUUOAFOEII-UHFFFAOYSA-N 5481 CHEMBL272689::1-[(2-amino-9H-purin-6-yl)oxy]propan-2-one::O6-Substituted Guanine Deriv. 21 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 192000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5481&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329508 8035100 CHEMBL272689 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167372 Nc1nc(OCC(=C)c2ccccc2)c2[nH]cnc2n1 InChI=1S/C14H13N5O/c1-9(10-5-3-2-4-6-10)7-20-13-11-12(17-8-16-11)18-14(15)19-13/h2-6,8H,1,7H2,(H3,15,16,17,18,19) AMVHOPCPUFSVFC-UHFFFAOYSA-N 5479 CHEMBL334050::6-[(2-phenylprop-2-en-1-yl)oxy]-9H-purin-2-amine::O6-Substituted Guanine Deriv. 19 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 37500 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5479 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5479&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329506 8035098 CHEMBL334050 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167373 Nc1nc(OCC2=CCCC2)c2[nH]cnc2n1 |t:6| InChI=1S/C11H13N5O/c12-11-15-9-8(13-6-14-9)10(16-11)17-5-7-3-1-2-4-7/h3,6H,1-2,4-5H2,(H3,12,13,14,15,16) BSCBVJDZICZHJY-UHFFFAOYSA-N 5484 6-(cyclopent-1-en-1-ylmethoxy)-9H-purin-2-amine::CHEMBL405259::O6-Substituted Guanine Deriv. 24 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 390 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5484 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5484&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329510 8035103 CHEMBL405259 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167374 Nc1nc(OCC2CCC2)c2[nH]cnc2n1 InChI=1S/C10H13N5O/c11-10-14-8-7(12-5-13-8)9(15-10)16-4-6-2-1-3-6/h5-6H,1-4H2,(H3,11,12,13,14,15) ZUJWIRJLHQQMHZ-UHFFFAOYSA-N 50093340 6-Cyclobutylmethoxy-9H-purin-2-ylamine::CHEMBL133293 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50093340 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50093340&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10704094 103991328 CHEMBL133293 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167375 Nc1nc(OCC(=C)c2ccccc2)c2[nH]cnc2n1 InChI=1S/C14H13N5O/c1-9(10-5-3-2-4-6-10)7-20-13-11-12(17-8-16-11)18-14(15)19-13/h2-6,8H,1,7H2,(H3,15,16,17,18,19) AMVHOPCPUFSVFC-UHFFFAOYSA-N 5479 CHEMBL334050::6-[(2-phenylprop-2-en-1-yl)oxy]-9H-purin-2-amine::O6-Substituted Guanine Deriv. 19 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 77000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5479 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5479&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329506 8035098 CHEMBL334050 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167376 CCC(=O)COc1nc(N)nc2nc[nH]c12 InChI=1S/C9H11N5O2/c1-2-5(15)3-16-8-6-7(12-4-11-6)13-9(10)14-8/h4H,2-3H2,1H3,(H3,10,11,12,13,14) HKHVWPUUQMFZGF-UHFFFAOYSA-N 50093325 1-(2-Amino-9H-purin-6-yloxy)-butan-2-one::CHEMBL337713 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 151000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50093325 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50093325&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10632766 103991322 CHEMBL337713 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167377 CCCOc1nc(N)nc2nc[nH]c12 InChI=1S/C8H11N5O/c1-2-3-14-7-5-6(11-4-10-5)12-8(9)13-7/h4H,2-3H2,1H3,(H3,9,10,11,12,13) WWMYHQCOEFJVFT-UHFFFAOYSA-N 5461 6-propoxy-9H-purin-2-amine::CHEMBL272692::O6-Substituted Guanine Deriv. 3 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5461 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5461&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 95802 8035080 CHEMBL272692 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167378 CCCCCCOc1nc(N)nc2nc[nH]c12 InChI=1S/C11H17N5O/c1-2-3-4-5-6-17-10-8-9(14-7-13-8)15-11(12)16-10/h7H,2-6H2,1H3,(H3,12,13,14,15,16) SDINAMBPZFEEIO-UHFFFAOYSA-N 50093343 6-Hexyloxy-9H-purin-2-ylamine::CHEMBL338451 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 554000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50093343 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50093343&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10681258 103991329 CHEMBL338451 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167379 Nc1nc(OCC2CCC=CC2)c2[nH]cnc2n1 |c:9| InChI=1S/C12H15N5O/c13-12-16-10-9(14-7-15-10)11(17-12)18-6-8-4-2-1-3-5-8/h1-2,7-8H,3-6H2,(H3,13,14,15,16,17) RXNXVXFFAAPSTR-UHFFFAOYSA-N 5487 CHEMBL115498::6-(cyclohex-3-en-1-ylmethoxy)-9H-purin-2-amine::O6-Substituted Guanine Deriv. 27 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5487 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5487&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329512 8035106 CHEMBL115498 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167380 COC(COc1nc(N)nc2nc[nH]c12)(OC)c1ccccc1 InChI=1S/C15H17N5O3/c1-21-15(22-2,10-6-4-3-5-7-10)8-23-13-11-12(18-9-17-11)19-14(16)20-13/h3-7,9H,8H2,1-2H3,(H3,16,17,18,19,20) HGTDQLRRAUJAGC-UHFFFAOYSA-N 50093345 6-(2,2-Dimethoxy-2-phenyl-ethoxy)-9H-purin-2-ylamine::CHEMBL130392 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50093345 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50093345&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10639059 103991330 CHEMBL130392 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167381 CCC(=C)COc1nc(N)nc2nc[nH]c12 InChI=1S/C10H13N5O/c1-3-6(2)4-16-9-7-8(13-5-12-7)14-10(11)15-9/h5H,2-4H2,1H3,(H3,11,12,13,14,15) WAAPCTQGFXRWIC-UHFFFAOYSA-N 5477 6-(2-methylidenebutoxy)-9H-purin-2-amine::CHEMBL270982::O6-Substituted Guanine Deriv. 17 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 16000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5477 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5477&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329504 8035096 CHEMBL270982 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167382 Nc1nc(OCC2CCCCC2)c2[nH]cnc2n1 InChI=1S/C12H17N5O/c13-12-16-10-9(14-7-15-10)11(17-12)18-6-8-4-2-1-3-5-8/h7-8H,1-6H2,(H3,13,14,15,16,17) MWGXGTJJAOZBNW-UHFFFAOYSA-N 5485 6-(cyclohexylmethoxy)-9H-purin-2-amine::CHEMBL269881::NU2058 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5485 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5485&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 4564 8035104 CHEMBL269881 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167383 CCC(=O)COc1nc(N)nc2nc[nH]c12 InChI=1S/C9H11N5O2/c1-2-5(15)3-16-8-6-7(12-4-11-6)13-9(10)14-8/h4H,2-3H2,1H3,(H3,10,11,12,13,14) HKHVWPUUQMFZGF-UHFFFAOYSA-N 50093325 1-(2-Amino-9H-purin-6-yloxy)-butan-2-one::CHEMBL337713 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 93200 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50093325 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50093325&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10632766 103991322 CHEMBL337713 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167384 CC\C=C/CCOc1nc(N)nc2nc[nH]c12 InChI=1S/C11H15N5O/c1-2-3-4-5-6-17-10-8-9(14-7-13-8)15-11(12)16-10/h3-4,7H,2,5-6H2,1H3,(H3,12,13,14,15,16) ZCPPPKCYLHUUHN-UHFFFAOYSA-N 50093347 6-Hex-3-enyloxy-9H-purin-2-ylamine::CHEMBL129960 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50093347 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50093347&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10489822 103991332 CHEMBL129960 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167385 Nc1nc(OCC#C)c2[nH]cnc2n1 InChI=1S/C8H7N5O/c1-2-3-14-7-5-6(11-4-10-5)12-8(9)13-7/h1,4H,3H2,(H3,9,10,11,12,13) MVZMHAXNJPJZIS-UHFFFAOYSA-N 5472 6-(prop-2-yn-1-yloxy)-9H-purin-2-amine::CHEMBL270483::O6-Substituted Guanine Deriv. 12 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 11900 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5472 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5472&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329500 8035091 CHEMBL270483 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167386 CCOC(C)(COc1nc(N)nc2nc[nH]c12)OCC InChI=1S/C12H19N5O3/c1-4-19-12(3,20-5-2)6-18-10-8-9(15-7-14-8)16-11(13)17-10/h7H,4-6H2,1-3H3,(H3,13,14,15,16,17) XQSITHSREIZTRT-UHFFFAOYSA-N 5501 CHEMBL405533::6-(2,2-diethoxypropoxy)-9H-purin-2-amine::O6-Substituted Guanine Deriv. 41 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5501 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5501&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329525 8035120 CHEMBL405533 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167387 CC1(C)OCC(COc2nc(N)nc3nc[nH]c23)O1 InChI=1S/C11H15N5O3/c1-11(2)18-4-6(19-11)3-17-9-7-8(14-5-13-7)15-10(12)16-9/h5-6H,3-4H2,1-2H3,(H3,12,13,14,15,16) RLXYBYJPRBYHSL-UHFFFAOYSA-N 50241514 6-(2,2-Dimethyl-[1,3]dioxolan-4-ylmethoxy)-9H-purin-2-ylamine::6-((2,2-dimethyl-1,3-dioxolan-4-yl)methoxy)-9H-purin-2-amine::CHEMBL272397 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50241514 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50241514&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10635398 104098799 CHEMBL272397 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167388 CC(=C)COc1nc(N)nc2nc[nH]c12 InChI=1S/C9H11N5O/c1-5(2)3-15-8-6-7(12-4-11-6)13-9(10)14-8/h4H,1,3H2,2H3,(H3,10,11,12,13,14) SKVCEFNZQMPWEN-UHFFFAOYSA-N 5476 6-[(2-methylprop-2-en-1-yl)oxy]-9H-purin-2-amine::CHEMBL407876::O6-Substituted Guanine Deriv. 16 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 13500 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5476 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5476&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329503 8035095 CHEMBL407876 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167389 CC(=C)[C@@H]1CCC(COc2nc(N)nc3nc[nH]c23)=CC1 |c:20| InChI=1S/C15H19N5O/c1-9(2)11-5-3-10(4-6-11)7-21-14-12-13(18-8-17-12)19-15(16)20-14/h3,8,11H,1,4-7H2,2H3,(H3,16,17,18,19,20) SPADJAXDGBDSFV-UHFFFAOYSA-N 50241513 6-(4-Isopropenyl-cyclohex-1-enylmethoxy)-9H-purin-2-ylamine::(R)-6-((4-(prop-1-en-2-yl)cyclohex-1-enyl)methoxy)-9H-purin-2-amine::CHEMBL272182 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 2600 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50241513 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50241513&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44457175 104098798 CHEMBL272182 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167390 CC(C)CCOc1nc(N)nc2nc[nH]c12 InChI=1S/C10H15N5O/c1-6(2)3-4-16-9-7-8(13-5-12-7)14-10(11)15-9/h5-6H,3-4H2,1-2H3,(H3,11,12,13,14,15) OYBZHCFDWLRUHE-UHFFFAOYSA-N 5469 CHEMBL269872::6-(3-methylbutoxy)-9H-purin-2-amine::O6-Substituted Guanine Deriv. 11 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5469 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5469&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329499 8035088 CHEMBL269872 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167391 CC(=C)COc1nc(N)nc2nc[nH]c12 InChI=1S/C9H11N5O/c1-5(2)3-15-8-6-7(12-4-11-6)13-9(10)14-8/h4H,1,3H2,2H3,(H3,10,11,12,13,14) SKVCEFNZQMPWEN-UHFFFAOYSA-N 5476 6-[(2-methylprop-2-en-1-yl)oxy]-9H-purin-2-amine::CHEMBL407876::O6-Substituted Guanine Deriv. 16 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 13500 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5476 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5476&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329503 8035095 CHEMBL407876 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167392 Nc1nc(OCC#C)c2[nH]cnc2n1 InChI=1S/C8H7N5O/c1-2-3-14-7-5-6(11-4-10-5)12-8(9)13-7/h1,4H,3H2,(H3,9,10,11,12,13) MVZMHAXNJPJZIS-UHFFFAOYSA-N 5472 6-(prop-2-yn-1-yloxy)-9H-purin-2-amine::CHEMBL270483::O6-Substituted Guanine Deriv. 12 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 20000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5472 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5472&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329500 8035091 CHEMBL270483 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167393 CCCCOc1nc(N)nc2nc[nH]c12 InChI=1S/C9H13N5O/c1-2-3-4-15-8-6-7(12-5-11-6)13-9(10)14-8/h5H,2-4H2,1H3,(H3,10,11,12,13,14) SPHOZXNZJHRHSL-UHFFFAOYSA-N 5462 CHEMBL270946::6-butoxy-9H-purin-2-amine::O6-Substituted Guanine Deriv. 4 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 493000.0 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5462 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5462&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 95803 8035081 CHEMBL270946 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167394 CC(C)C(=C)COc1nc(N)nc2nc[nH]c12 InChI=1S/C11H15N5O/c1-6(2)7(3)4-17-10-8-9(14-5-13-8)15-11(12)16-10/h5-6H,3-4H2,1-2H3,(H3,12,13,14,15,16) GVEXNMKDLGGAPR-UHFFFAOYSA-N 5478 CHEMBL407877::6-(3-methyl-2-methylidenebutoxy)-9H-purin-2-amine::O6-Substituted Guanine Deriv. 18 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5478 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5478&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329505 8035097 CHEMBL407877 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167395 CC(C)C(=O)COc1nc(N)nc2nc[nH]c12 InChI=1S/C10H13N5O2/c1-5(2)6(16)3-17-9-7-8(13-4-12-7)14-10(11)15-9/h4-5H,3H2,1-2H3,(H3,11,12,13,14,15) BEXUQVHWMLPYKY-UHFFFAOYSA-N 5482 1-[(2-amino-9H-purin-6-yl)oxy]-3-methylbutan-2-one::CHEMBL272690::O6-Substituted Guanine Deriv. 22 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens >1000000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5482 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5482&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 445940 8035101 CHEMBL272690 DB03663 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78 50167396 CCCCCOc1nc(N)nc2nc[nH]c12 InChI=1S/C10H15N5O/c1-2-3-4-5-16-9-7-8(13-6-12-7)14-10(11)15-9/h6H,2-5H2,1H3,(H3,11,12,13,14,15) LSYVREFNTIHKNQ-UHFFFAOYSA-N 5463 CHEMBL406495::6-(pentyloxy)-9H-purin-2-amine::O6-Substituted Guanine Deriv. 5 Methylated-DNA--protein-cysteine methyltransferase Homo sapiens 1006000 ChEMBL 10.1021/jm000961o 10.7270/Q2RF5T8B 11063604 Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT 11/20/2000 11/10/2009 Newcastle University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=5463 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002339&target=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=5463&enzyme=Methylated-DNA--protein-cysteine+methyltransferase&column=ki&startPg=0&Increment=50&submit=Search 5329494 8035082 CHEMBL406495 1 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN 1EH8,1EH7,1EH6,1YFH,1QNT,1T39,7WZ8,9QFK,9QFG,9QFE,9QFB,9QF2,9QEY,9QFW,9QFQ,8FDU,8FDT Methylated-DNA--protein-cysteine methyltransferase MGMT_HUMAN P16455 Q5VY78