BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50145856 Nc1nc(N)c2nc(Cn3c4ccccc4c4ccccc34)cnc2n1 InChI=1S/C19H15N7/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-14-7-3-1-5-12(14)13-6-2-4-8-15(13)26/h1-9H,10H2,(H4,20,21,22,24,25) IEDDLXNDDDZXMU-UHFFFAOYSA-N 50082920 6-Carbazol-9-ylmethyl-pteridine-2,4-diamine::CHEMBL423200 Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii 12 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082920 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9977&target=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082920&enzyme=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search 486244 103982655 CHEMBL423200 1 MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKTGDSGLPSPSVGKRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNGVPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEEDRKKREQKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 7FGY,7FGX,7FGW,4KY4,4ECK,6N1T,6N1S,6AOI,6AOH,6AOG,5T0L,4KYA,4EIL Bifunctional dihydrofolate reductase-thymidylate synthase DRTS_TOXGO Q07422 50145857 Nc1nc(N)c2nc(CN(c3ccccc3)c3ccccc3)cnc2n1 InChI=1S/C19H17N7/c20-17-16-18(25-19(21)24-17)22-11-13(23-16)12-26(14-7-3-1-4-8-14)15-9-5-2-6-10-15/h1-11H,12H2,(H4,20,21,22,24,25) WVNIWFAZVBLXHS-UHFFFAOYSA-N 50082921 6-[(Diphenylamino)-methyl]-pteridine-2,4-diamine::CHEMBL424113 Dihydrofolate reductase Rattus norvegicus 4000 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082921 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1910&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082921&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486242 103982656 CHEMBL424113 1 MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKFEVYEKKD Dihydrofolate reductase DYR_RAT Q920D2 50145858 Nc1nc(N)c2nc(CN3c4ccccc4Sc4ccccc34)cnc2n1 InChI=1S/C19H15N7S/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-12-5-1-3-7-14(12)27-15-8-4-2-6-13(15)26/h1-9H,10H2,(H4,20,21,22,24,25) VMOVOUMHZIMENS-UHFFFAOYSA-N 50082922 6-Phenothiazin-10-ylmethyl-pteridine-2,4-diamine::CHEMBL144200 Dihydrofolate reductase Mycobacterium avium 29 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082922 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1880&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082922&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486243 103982657 CHEMBL144200 1 MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRPLPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEVTEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRPS 8VTC,2W3W,2W3V Dihydrofolate reductase O30463_MYCAV O30463 50145859 COc1cc(cc(c1OC)OC)Cc2cnc(nc2N)N InChI=1S/C14H18N4O3/c1-19-10-5-8(6-11(20-2)12(10)21-3)4-9-7-17-14(16)18-13(9)15/h5-7H,4H2,1-3H3,(H4,15,16,17,18) IEDVJHCEMCRBQM-UHFFFAOYSA-N 18069 CHEMBL22::TMP::Trimethoprim (TMP)::5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine::Trimethoprim::US10870625, Compound TMP Dihydrofolate reductase Rattus norvegicus 130000 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18069 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1910&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18069&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search TOP 1DG5,1DYR,2BFM,2W3A,2W3V,2W9G,2W9H,2W9S,3FL9,3FRB,3FRE,3JW3,3JW5,3N0H,3S3V,3TQ8,4G8Z,4KM2,4XT7,6RUL,6RUM,6XG4,6XG5,7F3Z,7MYL,7MYM,7NAE,7R6G,8SZE,8VTC 5578 46518184 CHEMBL22 DB00440 C01965 1 MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKFEVYEKKD Dihydrofolate reductase DYR_RAT Q920D2 50145860 COc1cc(NCc2ccc3nc(N)nc(N)c3c2C)cc(OC)c1OC InChI=1S/C19H23N5O3/c1-10-11(5-6-13-16(10)18(20)24-19(21)23-13)9-22-12-7-14(25-2)17(27-4)15(8-12)26-3/h5-8,22H,9H2,1-4H3,(H4,20,21,23,24) NOYPYLRCIDNJJB-UHFFFAOYSA-N 18268 5-methyl-6-{[(3,4,5-trimethoxyphenyl)amino]methyl}quinazoline-2,4-diamine::TMQ::CHEMBL119::Trimetrexate::US11111252, Compound TMQ::US11530198, Example Trimetrexate Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii 10 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18268 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9977&target=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18268&enzyme=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search 5583 46518373 CHEMBL119 DB01157 C11154 1 MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKTGDSGLPSPSVGKRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNGVPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEEDRKKREQKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 7FGY,7FGX,7FGW,4KY4,4ECK,6N1T,6N1S,6AOI,6AOH,6AOG,5T0L,4KYA,4EIL Bifunctional dihydrofolate reductase-thymidylate synthase DRTS_TOXGO Q07422 50145861 Nc1nc(N)c2nc(CN(c3ccccc3)c3ccccc3)cnc2n1 InChI=1S/C19H17N7/c20-17-16-18(25-19(21)24-17)22-11-13(23-16)12-26(14-7-3-1-4-8-14)15-9-5-2-6-10-15/h1-11H,12H2,(H4,20,21,22,24,25) WVNIWFAZVBLXHS-UHFFFAOYSA-N 50082921 6-[(Diphenylamino)-methyl]-pteridine-2,4-diamine::CHEMBL424113 Dihydrofolate reductase Mycobacterium avium 3700 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082921 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1880&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082921&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486242 103982656 CHEMBL424113 1 MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRPLPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEVTEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRPS 8VTC,2W3W,2W3V Dihydrofolate reductase O30463_MYCAV O30463 50145862 Nc1nc(N)c2nc(CN3c4ccccc4Sc4ccccc34)cnc2n1 InChI=1S/C19H15N7S/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-12-5-1-3-7-14(12)27-15-8-4-2-6-13(15)26/h1-9H,10H2,(H4,20,21,22,24,25) VMOVOUMHZIMENS-UHFFFAOYSA-N 50082922 6-Phenothiazin-10-ylmethyl-pteridine-2,4-diamine::CHEMBL144200 Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii 110 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082922 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9977&target=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082922&enzyme=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search 486243 103982657 CHEMBL144200 1 MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKTGDSGLPSPSVGKRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNGVPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEEDRKKREQKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 7FGY,7FGX,7FGW,4KY4,4ECK,6N1T,6N1S,6AOI,6AOH,6AOG,5T0L,4KYA,4EIL Bifunctional dihydrofolate reductase-thymidylate synthase DRTS_TOXGO Q07422 50145863 Nc1nc(N)c2nc(CN(c3ccccc3)c3ccccc3)cnc2n1 InChI=1S/C19H17N7/c20-17-16-18(25-19(21)24-17)22-11-13(23-16)12-26(14-7-3-1-4-8-14)15-9-5-2-6-10-15/h1-11H,12H2,(H4,20,21,22,24,25) WVNIWFAZVBLXHS-UHFFFAOYSA-N 50082921 6-[(Diphenylamino)-methyl]-pteridine-2,4-diamine::CHEMBL424113 Dihydrofolate reductase Pneumocystis carinii 4900 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082921 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1885&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082921&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486242 103982656 CHEMBL424113 1 MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL 4QJZ,4IXE,4CD2,3TD8,3NZC,3NZB,3NZA,3NZ9,3NZ6,3CD2,2FZI,2FZH,2CD2,1S3Y,1LY4,1LY3,1KLK,1E26,1DYR,1DAJ,1CD2,1VJ3 Dihydrofolate reductase DYR_PNECA P16184 50145864 Nc1nc(N)c2nc(CN3c4ccccc4CCc4ccccc34)cnc2n1 InChI=1S/C21H19N7/c22-19-18-20(27-21(23)26-19)24-11-15(25-18)12-28-16-7-3-1-5-13(16)9-10-14-6-2-4-8-17(14)28/h1-8,11H,9-10,12H2,(H4,22,23,24,26,27) QQZVNNFURYIWAD-UHFFFAOYSA-N 50082924 6-(10,11-Dihydro-dibenzo[b,f]azepin-5-ylmethyl)-pteridine-2,4-diamine::CHEMBL342086 Dihydrofolate reductase Rattus norvegicus 5100 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082924 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1910&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082924&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 481460 103982659 CHEMBL342086 1 MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKFEVYEKKD Dihydrofolate reductase DYR_RAT Q920D2 50145865 Nc1nc(N)c2nc(CN3c4ccccc4Cc4ccccc34)cnc2n1 InChI=1S/C20H17N7/c21-18-17-19(26-20(22)25-18)23-10-14(24-17)11-27-15-7-3-1-5-12(15)9-13-6-2-4-8-16(13)27/h1-8,10H,9,11H2,(H4,21,22,23,25,26) VMBSXLVZCRYQJX-UHFFFAOYSA-N 50082923 6-(9H-Acridin-10-ylmethyl)-pteridine-2,4-diamine::6-(acridin-10(9H)-ylmethyl)pteridine-2,4-diamine::CHEMBL144839 Dihydrofolate reductase Mycobacterium avium 17 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082923 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1880&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082923&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 483225 103982658 CHEMBL144839 1 MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRPLPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEVTEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRPS 8VTC,2W3W,2W3V Dihydrofolate reductase O30463_MYCAV O30463 50145866 c1ccc2c(c1)C=Cc3ccccc3N2Cc4cnc5c(n4)c(nc(n5)N)N InChI=1S/C21H17N7/c22-19-18-20(27-21(23)26-19)24-11-15(25-18)12-28-16-7-3-1-5-13(16)9-10-14-6-2-4-8-17(14)28/h1-11H,12H2,(H4,22,23,24,26,27) NXCCIJQEAKMFGW-UHFFFAOYSA-N 18506 6-{2-azatricyclo[9.4.0.0^{3,8}]pentadeca-1(11),3(8),4,6,9,12,14-heptaen-2-ylmethyl}pteridine-2,4-diamine::CHEMBL301769::Pteridine compound, 17 Dihydrofolate reductase Mycobacterium avium 12 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18506 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1880&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18506&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search PMD 1KLK 446744 46518579 CHEMBL301769 DB08406 1 MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRPLPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEVTEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRPS 8VTC,2W3W,2W3V Dihydrofolate reductase O30463_MYCAV O30463 50145867 Nc1nc(N)c2nc(CN3c4ccccc4Oc4ccccc34)cnc2n1 InChI=1S/C19H15N7O/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-12-5-1-3-7-14(12)27-15-8-4-2-6-13(15)26/h1-9H,10H2,(H4,20,21,22,24,25) KPLPHRUKUJCKFM-UHFFFAOYSA-N 50082925 6-Phenoxazin-10-ylmethyl-pteridine-2,4-diamine::CHEMBL423381 Dihydrofolate reductase Pneumocystis carinii 3400 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082925 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1885&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082925&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486241 103982660 CHEMBL423381 1 MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL 4QJZ,4IXE,4CD2,3TD8,3NZC,3NZB,3NZA,3NZ9,3NZ6,3CD2,2FZI,2FZH,2CD2,1S3Y,1LY4,1LY3,1KLK,1E26,1DYR,1DAJ,1CD2,1VJ3 Dihydrofolate reductase DYR_PNECA P16184 50145868 Nc1nc(N)c2nc(CN3c4ccccc4CCc4ccccc34)cnc2n1 InChI=1S/C21H19N7/c22-19-18-20(27-21(23)26-19)24-11-15(25-18)12-28-16-7-3-1-5-13(16)9-10-14-6-2-4-8-17(14)28/h1-8,11H,9-10,12H2,(H4,22,23,24,26,27) QQZVNNFURYIWAD-UHFFFAOYSA-N 50082924 6-(10,11-Dihydro-dibenzo[b,f]azepin-5-ylmethyl)-pteridine-2,4-diamine::CHEMBL342086 Dihydrofolate reductase Pneumocystis carinii 1400 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082924 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1885&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082924&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 481460 103982659 CHEMBL342086 1 MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL 4QJZ,4IXE,4CD2,3TD8,3NZC,3NZB,3NZA,3NZ9,3NZ6,3CD2,2FZI,2FZH,2CD2,1S3Y,1LY4,1LY3,1KLK,1E26,1DYR,1DAJ,1CD2,1VJ3 Dihydrofolate reductase DYR_PNECA P16184 50145869 Nc1nc(N)c2nc(CN3c4ccccc4Cc4ccccc34)cnc2n1 InChI=1S/C20H17N7/c21-18-17-19(26-20(22)25-18)23-10-14(24-17)11-27-15-7-3-1-5-12(15)9-13-6-2-4-8-16(13)27/h1-8,10H,9,11H2,(H4,21,22,23,25,26) VMBSXLVZCRYQJX-UHFFFAOYSA-N 50082923 6-(9H-Acridin-10-ylmethyl)-pteridine-2,4-diamine::6-(acridin-10(9H)-ylmethyl)pteridine-2,4-diamine::CHEMBL144839 Dihydrofolate reductase Rattus norvegicus 27 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082923 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1910&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082923&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 483225 103982658 CHEMBL144839 1 MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKFEVYEKKD Dihydrofolate reductase DYR_RAT Q920D2 50145870 Nc1nc(N)c2nc(CN(c3ccccc3)c3ccccc3)cnc2n1 InChI=1S/C19H17N7/c20-17-16-18(25-19(21)24-17)22-11-13(23-16)12-26(14-7-3-1-4-8-14)15-9-5-2-6-10-15/h1-11H,12H2,(H4,20,21,22,24,25) WVNIWFAZVBLXHS-UHFFFAOYSA-N 50082921 6-[(Diphenylamino)-methyl]-pteridine-2,4-diamine::CHEMBL424113 Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii 1300 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082921 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9977&target=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082921&enzyme=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search 486242 103982656 CHEMBL424113 1 MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKTGDSGLPSPSVGKRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNGVPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEEDRKKREQKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 7FGY,7FGX,7FGW,4KY4,4ECK,6N1T,6N1S,6AOI,6AOH,6AOG,5T0L,4KYA,4EIL Bifunctional dihydrofolate reductase-thymidylate synthase DRTS_TOXGO Q07422 50145871 Nc1nc(N)c2nc(CN3c4ccccc4Cc4ccccc34)cnc2n1 InChI=1S/C20H17N7/c21-18-17-19(26-20(22)25-18)23-10-14(24-17)11-27-15-7-3-1-5-12(15)9-13-6-2-4-8-16(13)27/h1-8,10H,9,11H2,(H4,21,22,23,25,26) VMBSXLVZCRYQJX-UHFFFAOYSA-N 50082923 6-(9H-Acridin-10-ylmethyl)-pteridine-2,4-diamine::6-(acridin-10(9H)-ylmethyl)pteridine-2,4-diamine::CHEMBL144839 Dihydrofolate reductase Pneumocystis carinii 42 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082923 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1885&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082923&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 483225 103982658 CHEMBL144839 1 MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL 4QJZ,4IXE,4CD2,3TD8,3NZC,3NZB,3NZA,3NZ9,3NZ6,3CD2,2FZI,2FZH,2CD2,1S3Y,1LY4,1LY3,1KLK,1E26,1DYR,1DAJ,1CD2,1VJ3 Dihydrofolate reductase DYR_PNECA P16184 50145872 Nc1nc(N)c2nc(CN3c4ccccc4Sc4ccccc34)cnc2n1 InChI=1S/C19H15N7S/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-12-5-1-3-7-14(12)27-15-8-4-2-6-13(15)26/h1-9H,10H2,(H4,20,21,22,24,25) VMOVOUMHZIMENS-UHFFFAOYSA-N 50082922 6-Phenothiazin-10-ylmethyl-pteridine-2,4-diamine::CHEMBL144200 Dihydrofolate reductase Pneumocystis carinii 120 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082922 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1885&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082922&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486243 103982657 CHEMBL144200 1 MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL 4QJZ,4IXE,4CD2,3TD8,3NZC,3NZB,3NZA,3NZ9,3NZ6,3CD2,2FZI,2FZH,2CD2,1S3Y,1LY4,1LY3,1KLK,1E26,1DYR,1DAJ,1CD2,1VJ3 Dihydrofolate reductase DYR_PNECA P16184 50145873 c1ccc2c(c1)C=Cc3ccccc3N2Cc4cnc5c(n4)c(nc(n5)N)N InChI=1S/C21H17N7/c22-19-18-20(27-21(23)26-19)24-11-15(25-18)12-28-16-7-3-1-5-13(16)9-10-14-6-2-4-8-17(14)28/h1-11H,12H2,(H4,22,23,24,26,27) NXCCIJQEAKMFGW-UHFFFAOYSA-N 18506 6-{2-azatricyclo[9.4.0.0^{3,8}]pentadeca-1(11),3(8),4,6,9,12,14-heptaen-2-ylmethyl}pteridine-2,4-diamine::CHEMBL301769::Pteridine compound, 17 Dihydrofolate reductase Rattus norvegicus 4400 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18506 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1910&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18506&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search PMD 1KLK 446744 46518579 CHEMBL301769 DB08406 1 MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKFEVYEKKD Dihydrofolate reductase DYR_RAT Q920D2 50145874 COc1cc(cc(c1OC)OC)Cc2cnc(nc2N)N InChI=1S/C14H18N4O3/c1-19-10-5-8(6-11(20-2)12(10)21-3)4-9-7-17-14(16)18-13(9)15/h5-7H,4H2,1-3H3,(H4,15,16,17,18) IEDVJHCEMCRBQM-UHFFFAOYSA-N 18069 CHEMBL22::TMP::Trimethoprim (TMP)::5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine::Trimethoprim::US10870625, Compound TMP Dihydrofolate reductase Mycobacterium avium 190 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18069 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1880&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18069&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search TOP 1DG5,1DYR,2BFM,2W3A,2W3V,2W9G,2W9H,2W9S,3FL9,3FRB,3FRE,3JW3,3JW5,3N0H,3S3V,3TQ8,4G8Z,4KM2,4XT7,6RUL,6RUM,6XG4,6XG5,7F3Z,7MYL,7MYM,7NAE,7R6G,8SZE,8VTC 5578 46518184 CHEMBL22 DB00440 C01965 1 MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRPLPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEVTEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRPS 8VTC,2W3W,2W3V Dihydrofolate reductase O30463_MYCAV O30463 50145875 Nc1nc(N)c2nc(CN3c4ccccc4Sc4ccccc34)cnc2n1 InChI=1S/C19H15N7S/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-12-5-1-3-7-14(12)27-15-8-4-2-6-13(15)26/h1-9H,10H2,(H4,20,21,22,24,25) VMOVOUMHZIMENS-UHFFFAOYSA-N 50082922 6-Phenothiazin-10-ylmethyl-pteridine-2,4-diamine::CHEMBL144200 Dihydrofolate reductase Rattus norvegicus 200 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082922 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1910&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082922&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486243 103982657 CHEMBL144200 1 MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKFEVYEKKD Dihydrofolate reductase DYR_RAT Q920D2 50145876 COc1cc(cc(c1OC)OC)Cc2cnc(nc2N)N InChI=1S/C14H18N4O3/c1-19-10-5-8(6-11(20-2)12(10)21-3)4-9-7-17-14(16)18-13(9)15/h5-7H,4H2,1-3H3,(H4,15,16,17,18) IEDVJHCEMCRBQM-UHFFFAOYSA-N 18069 CHEMBL22::TMP::Trimethoprim (TMP)::5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine::Trimethoprim::US10870625, Compound TMP Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii 2700 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18069 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9977&target=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18069&enzyme=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search TOP 1DG5,1DYR,2BFM,2W3A,2W3V,2W9G,2W9H,2W9S,3FL9,3FRB,3FRE,3JW3,3JW5,3N0H,3S3V,3TQ8,4G8Z,4KM2,4XT7,6RUL,6RUM,6XG4,6XG5,7F3Z,7MYL,7MYM,7NAE,7R6G,8SZE,8VTC 5578 46518184 CHEMBL22 DB00440 C01965 1 MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKTGDSGLPSPSVGKRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNGVPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEEDRKKREQKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 7FGY,7FGX,7FGW,4KY4,4ECK,6N1T,6N1S,6AOI,6AOH,6AOG,5T0L,4KYA,4EIL Bifunctional dihydrofolate reductase-thymidylate synthase DRTS_TOXGO Q07422 50145877 Nc1nc(N)c2nc(Cn3c4ccccc4c4ccccc34)cnc2n1 InChI=1S/C19H15N7/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-14-7-3-1-5-12(14)13-6-2-4-8-15(13)26/h1-9H,10H2,(H4,20,21,22,24,25) IEDDLXNDDDZXMU-UHFFFAOYSA-N 50082920 6-Carbazol-9-ylmethyl-pteridine-2,4-diamine::CHEMBL423200 Dihydrofolate reductase Rattus norvegicus 55.0 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082920 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1910&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082920&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486244 103982655 CHEMBL423200 1 MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKFEVYEKKD Dihydrofolate reductase DYR_RAT Q920D2 50145878 Nc1nc(N)c2nc(CN3c4ccccc4Oc4ccccc34)cnc2n1 InChI=1S/C19H15N7O/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-12-5-1-3-7-14(12)27-15-8-4-2-6-13(15)26/h1-9H,10H2,(H4,20,21,22,24,25) KPLPHRUKUJCKFM-UHFFFAOYSA-N 50082925 6-Phenoxazin-10-ylmethyl-pteridine-2,4-diamine::CHEMBL423381 Dihydrofolate reductase Mycobacterium avium 2500 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082925 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1880&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082925&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486241 103982660 CHEMBL423381 1 MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRPLPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEVTEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRPS 8VTC,2W3W,2W3V Dihydrofolate reductase O30463_MYCAV O30463 50145879 COc1cc(NCc2ccc3nc(N)nc(N)c3c2C)cc(OC)c1OC InChI=1S/C19H23N5O3/c1-10-11(5-6-13-16(10)18(20)24-19(21)23-13)9-22-12-7-14(25-2)17(27-4)15(8-12)26-3/h5-8,22H,9H2,1-4H3,(H4,20,21,23,24) NOYPYLRCIDNJJB-UHFFFAOYSA-N 18268 5-methyl-6-{[(3,4,5-trimethoxyphenyl)amino]methyl}quinazoline-2,4-diamine::TMQ::CHEMBL119::Trimetrexate::US11111252, Compound TMQ::US11530198, Example Trimetrexate Dihydrofolate reductase Pneumocystis carinii 42 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18268 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1885&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18268&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 5583 46518373 CHEMBL119 DB01157 C11154 1 MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL 4QJZ,4IXE,4CD2,3TD8,3NZC,3NZB,3NZA,3NZ9,3NZ6,3CD2,2FZI,2FZH,2CD2,1S3Y,1LY4,1LY3,1KLK,1E26,1DYR,1DAJ,1CD2,1VJ3 Dihydrofolate reductase DYR_PNECA P16184 50145880 c1ccc2c(c1)C=Cc3ccccc3N2Cc4cnc5c(n4)c(nc(n5)N)N InChI=1S/C21H17N7/c22-19-18-20(27-21(23)26-19)24-11-15(25-18)12-28-16-7-3-1-5-13(16)9-10-14-6-2-4-8-17(14)28/h1-11H,12H2,(H4,22,23,24,26,27) NXCCIJQEAKMFGW-UHFFFAOYSA-N 18506 6-{2-azatricyclo[9.4.0.0^{3,8}]pentadeca-1(11),3(8),4,6,9,12,14-heptaen-2-ylmethyl}pteridine-2,4-diamine::CHEMBL301769::Pteridine compound, 17 Dihydrofolate reductase Pneumocystis carinii 210 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18506 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1885&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18506&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search PMD 1KLK 446744 46518579 CHEMBL301769 DB08406 1 MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL 4QJZ,4IXE,4CD2,3TD8,3NZC,3NZB,3NZA,3NZ9,3NZ6,3CD2,2FZI,2FZH,2CD2,1S3Y,1LY4,1LY3,1KLK,1E26,1DYR,1DAJ,1CD2,1VJ3 Dihydrofolate reductase DYR_PNECA P16184 50145881 Nc1nc(N)c2nc(CN3c4ccccc4Cc4ccccc34)cnc2n1 InChI=1S/C20H17N7/c21-18-17-19(26-20(22)25-18)23-10-14(24-17)11-27-15-7-3-1-5-12(15)9-13-6-2-4-8-16(13)27/h1-8,10H,9,11H2,(H4,21,22,23,25,26) VMBSXLVZCRYQJX-UHFFFAOYSA-N 50082923 6-(9H-Acridin-10-ylmethyl)-pteridine-2,4-diamine::6-(acridin-10(9H)-ylmethyl)pteridine-2,4-diamine::CHEMBL144839 Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii 29 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082923 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9977&target=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082923&enzyme=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search 483225 103982658 CHEMBL144839 1 MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKTGDSGLPSPSVGKRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNGVPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEEDRKKREQKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 7FGY,7FGX,7FGW,4KY4,4ECK,6N1T,6N1S,6AOI,6AOH,6AOG,5T0L,4KYA,4EIL Bifunctional dihydrofolate reductase-thymidylate synthase DRTS_TOXGO Q07422 50145882 c1ccc2c(c1)C=Cc3ccccc3N2Cc4cnc5c(n4)c(nc(n5)N)N InChI=1S/C21H17N7/c22-19-18-20(27-21(23)26-19)24-11-15(25-18)12-28-16-7-3-1-5-13(16)9-10-14-6-2-4-8-17(14)28/h1-11H,12H2,(H4,22,23,24,26,27) NXCCIJQEAKMFGW-UHFFFAOYSA-N 18506 6-{2-azatricyclo[9.4.0.0^{3,8}]pentadeca-1(11),3(8),4,6,9,12,14-heptaen-2-ylmethyl}pteridine-2,4-diamine::CHEMBL301769::Pteridine compound, 17 Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii 43 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18506 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9977&target=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18506&enzyme=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search PMD 1KLK 446744 46518579 CHEMBL301769 DB08406 1 MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKTGDSGLPSPSVGKRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNGVPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEEDRKKREQKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 7FGY,7FGX,7FGW,4KY4,4ECK,6N1T,6N1S,6AOI,6AOH,6AOG,5T0L,4KYA,4EIL Bifunctional dihydrofolate reductase-thymidylate synthase DRTS_TOXGO Q07422 50145883 Nc1nc(N)c2nc(CN3c4ccccc4Oc4ccccc34)cnc2n1 InChI=1S/C19H15N7O/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-12-5-1-3-7-14(12)27-15-8-4-2-6-13(15)26/h1-9H,10H2,(H4,20,21,22,24,25) KPLPHRUKUJCKFM-UHFFFAOYSA-N 50082925 6-Phenoxazin-10-ylmethyl-pteridine-2,4-diamine::CHEMBL423381 Dihydrofolate reductase Rattus norvegicus 13000 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082925 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1910&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082925&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486241 103982660 CHEMBL423381 1 MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKFEVYEKKD Dihydrofolate reductase DYR_RAT Q920D2 50145884 Nc1nc(N)c2nc(CN3c4ccccc4Oc4ccccc34)cnc2n1 InChI=1S/C19H15N7O/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-12-5-1-3-7-14(12)27-15-8-4-2-6-13(15)26/h1-9H,10H2,(H4,20,21,22,24,25) KPLPHRUKUJCKFM-UHFFFAOYSA-N 50082925 6-Phenoxazin-10-ylmethyl-pteridine-2,4-diamine::CHEMBL423381 Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii 2200 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082925 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9977&target=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082925&enzyme=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search 486241 103982660 CHEMBL423381 1 MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKTGDSGLPSPSVGKRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNGVPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEEDRKKREQKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 7FGY,7FGX,7FGW,4KY4,4ECK,6N1T,6N1S,6AOI,6AOH,6AOG,5T0L,4KYA,4EIL Bifunctional dihydrofolate reductase-thymidylate synthase DRTS_TOXGO Q07422 50145885 Nc1nc(N)c2nc(CN3c4ccccc4CCc4ccccc34)cnc2n1 InChI=1S/C21H19N7/c22-19-18-20(27-21(23)26-19)24-11-15(25-18)12-28-16-7-3-1-5-13(16)9-10-14-6-2-4-8-17(14)28/h1-8,11H,9-10,12H2,(H4,22,23,24,26,27) QQZVNNFURYIWAD-UHFFFAOYSA-N 50082924 6-(10,11-Dihydro-dibenzo[b,f]azepin-5-ylmethyl)-pteridine-2,4-diamine::CHEMBL342086 Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii 910.0 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082924 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9977&target=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082924&enzyme=Bifunctional+dihydrofolate+reductase-thymidylate+synthase&column=ki&startPg=0&Increment=50&submit=Search 481460 103982659 CHEMBL342086 1 MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKTGDSGLPSPSVGKRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNGVPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEEDRKKREQKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 7FGY,7FGX,7FGW,4KY4,4ECK,6N1T,6N1S,6AOI,6AOH,6AOG,5T0L,4KYA,4EIL Bifunctional dihydrofolate reductase-thymidylate synthase DRTS_TOXGO Q07422 50145886 Nc1nc(N)c2nc(Cn3c4ccccc4c4ccccc34)cnc2n1 InChI=1S/C19H15N7/c20-17-16-18(25-19(21)24-17)22-9-11(23-16)10-26-14-7-3-1-5-12(14)13-6-2-4-8-15(13)26/h1-9H,10H2,(H4,20,21,22,24,25) IEDDLXNDDDZXMU-UHFFFAOYSA-N 50082920 6-Carbazol-9-ylmethyl-pteridine-2,4-diamine::CHEMBL423200 Dihydrofolate reductase Pneumocystis carinii 100 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50082920 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1885&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50082920&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 486244 103982655 CHEMBL423200 1 MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL 4QJZ,4IXE,4CD2,3TD8,3NZC,3NZB,3NZA,3NZ9,3NZ6,3CD2,2FZI,2FZH,2CD2,1S3Y,1LY4,1LY3,1KLK,1E26,1DYR,1DAJ,1CD2,1VJ3 Dihydrofolate reductase DYR_PNECA P16184 50145887 COc1cc(cc(c1OC)OC)Cc2cnc(nc2N)N InChI=1S/C14H18N4O3/c1-19-10-5-8(6-11(20-2)12(10)21-3)4-9-7-17-14(16)18-13(9)15/h5-7H,4H2,1-3H3,(H4,15,16,17,18) IEDVJHCEMCRBQM-UHFFFAOYSA-N 18069 CHEMBL22::TMP::Trimethoprim (TMP)::5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine::Trimethoprim::US10870625, Compound TMP Dihydrofolate reductase Pneumocystis carinii 12000 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18069 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1885&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18069&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search TOP 1DG5,1DYR,2BFM,2W3A,2W3V,2W9G,2W9H,2W9S,3FL9,3FRB,3FRE,3JW3,3JW5,3N0H,3S3V,3TQ8,4G8Z,4KM2,4XT7,6RUL,6RUM,6XG4,6XG5,7F3Z,7MYL,7MYM,7NAE,7R6G,8SZE,8VTC 5578 46518184 CHEMBL22 DB00440 C01965 1 MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL 4QJZ,4IXE,4CD2,3TD8,3NZC,3NZB,3NZA,3NZ9,3NZ6,3CD2,2FZI,2FZH,2CD2,1S3Y,1LY4,1LY3,1KLK,1E26,1DYR,1DAJ,1CD2,1VJ3 Dihydrofolate reductase DYR_PNECA P16184 50145888 COc1cc(NCc2ccc3nc(N)nc(N)c3c2C)cc(OC)c1OC InChI=1S/C19H23N5O3/c1-10-11(5-6-13-16(10)18(20)24-19(21)23-13)9-22-12-7-14(25-2)17(27-4)15(8-12)26-3/h5-8,22H,9H2,1-4H3,(H4,20,21,23,24) NOYPYLRCIDNJJB-UHFFFAOYSA-N 18268 5-methyl-6-{[(3,4,5-trimethoxyphenyl)amino]methyl}quinazoline-2,4-diamine::TMQ::CHEMBL119::Trimetrexate::US11111252, Compound TMQ::US11530198, Example Trimetrexate Dihydrofolate reductase Rattus norvegicus 3 ChEMBL 10.1021/jm990331q 10.7270/Q2S46R5R 10579848 Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF 12/17/1999 11/10/2009 Harvard Medical School http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18268 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1910&target=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18268&enzyme=Dihydrofolate+reductase&column=ki&startPg=0&Increment=50&submit=Search 5583 46518373 CHEMBL119 DB01157 C11154 1 MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKFEVYEKKD Dihydrofolate reductase DYR_RAT Q920D2