BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
51624408	CCCCN(CCCC)C(=O)CN1[C@H](c2cc(OC)c3c(c2)OCO3)C[C@@H](C(=O)O)[C@@H]1CC(C)(C)CCC	InChI=1S/C30H48N2O6/c1-7-10-13-31(14-11-8-2)27(33)19-32-23(21-15-25(36-6)28-26(16-21)37-20-38-28)17-22(29(34)35)24(32)18-30(4,5)12-9-3/h15-16,22-24H,7-14,17-20H2,1-6H3,(H,34,35)	JOFNRKXHKKTQIC-UHFFFAOYSA-N	50652928	CHEMBL5687007	Endothelin-1 receptor	Rat		 0.560000							ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50652928	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000504&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50652928&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			177372766	519645198							1	MGVLCFLASFWLALVGGAIADNAERYSANLSSHVEDFTPFPGTEFNFLGTTLQPPNLALPSNGSMHGYCPQQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEQHRTCMLNATTKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSSHKDSMN		Endothelin-1 receptor	EDNRA_RAT	P26684																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51624409	CCCCN(CCCC)C(=O)CN1[C@H](c2cc(OC)c3c(c2)OCO3)C[C@@H](C(=O)O)[C@@H]1CC(C)(C)CCC	InChI=1S/C30H48N2O6/c1-7-10-13-31(14-11-8-2)27(33)19-32-23(21-15-25(36-6)28-26(16-21)37-20-38-28)17-22(29(34)35)24(32)18-30(4,5)12-9-3/h15-16,22-24H,7-14,17-20H2,1-6H3,(H,34,35)	JOFNRKXHKKTQIC-UHFFFAOYSA-N	50652928	CHEMBL5687007	Endothelin receptor type B	Pig		 16700							ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50652928	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002666&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50652928&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			177372766	519645198							1	MQPLRSLCGRALVALIFACGVAGVQSEERGFPPAGATPPALRTGEIVAPPTKTFWPRGSNASLPRSSSPPQMPKGGRMAGPPARTLTPPPCEGPIEIKDTFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINVYKLLAEDWPFGVEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEALGFDMITTDYKGNRLRICLLHPTQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYDQNDSNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8XGR,8IY6,8IY5	Endothelin receptor type B	EDNRB_PIG	P35463	Q2WG87																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51624410	CCCCN(CCCC)C(=O)CN1[C@H](c2cc(OC)c3c(c2)OCO3)C[C@@H](C(=O)O)[C@@H]1CC(C)(C)CCC	InChI=1S/C30H48N2O6/c1-7-10-13-31(14-11-8-2)27(33)19-32-23(21-15-25(36-6)28-26(16-21)37-20-38-28)17-22(29(34)35)24(32)18-30(4,5)12-9-3/h15-16,22-24H,7-14,17-20H2,1-6H3,(H,34,35)	JOFNRKXHKKTQIC-UHFFFAOYSA-N	50652928	CHEMBL5687007	Endothelin-1 receptor	Human		 0.490000							ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50652928	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50652928&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			177372766	519645198							1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51624411	CCCCN(CCCC)C(=O)CN1[C@H](c2cc(OC)c3c(c2)OCO3)C[C@@H](C(=O)O)[C@@H]1CC(C)(C)CCC	InChI=1S/C30H48N2O6/c1-7-10-13-31(14-11-8-2)27(33)19-32-23(21-15-25(36-6)28-26(16-21)37-20-38-28)17-22(29(34)35)24(32)18-30(4,5)12-9-3/h15-16,22-24H,7-14,17-20H2,1-6H3,(H,34,35)	JOFNRKXHKKTQIC-UHFFFAOYSA-N	50652928	CHEMBL5687007	Endothelin receptor type B	Human		 15400							ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50652928	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50652928&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			177372766	519645198							1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51624412	CCCCN(CCCC)C(=O)CN1[C@H](c2cc(OC)c3c(c2)OCO3)C[C@@H](C(=O)O)[C@@H]1CC(C)(C)CCC	InChI=1S/C30H48N2O6/c1-7-10-13-31(14-11-8-2)27(33)19-32-23(21-15-25(36-6)28-26(16-21)37-20-38-28)17-22(29(34)35)24(32)18-30(4,5)12-9-3/h15-16,22-24H,7-14,17-20H2,1-6H3,(H,34,35)	JOFNRKXHKKTQIC-UHFFFAOYSA-N	50652928	CHEMBL5687007	Endothelin-1 receptor	Human	 0.460000								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50652928	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50652928&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			177372766	519645198							1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51624413	COc1ccc(cc1)C(=O)C(\Cc1cc(OC)c(OC)c(OC)c1)=C(/C([O-])=O)c1ccc2OCOc2c1	InChI=1S/C28H26O9/c1-32-19-8-5-17(6-9-19)26(29)20(11-16-12-23(33-2)27(35-4)24(13-16)34-3)25(28(30)31)18-7-10-21-22(14-18)37-15-36-21/h5-10,12-14H,11,15H2,1-4H3,(H,30,31)/p-1	OFCTYBMKKTVKCR-UHFFFAOYSA-M	50034263	PD-156707::Sodium; (Z)-2-benzo[1,3]dioxol-5-yl-4-(4-methoxy-phenyl)-4-oxo-3-(3,4,5-trimethoxy-benzyl)-but-2-enoate::CHEMBL25438	Endothelin-1 receptor	Homo sapiens	 0.380000								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50034263	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50034263&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			91929183	103942464		CHEMBL25438					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624414	CC(C)C[C@H](NC(=O)N1CCCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)C(=O)N[C@H](Cc1ccccn1)C(O)=O	InChI=1S/C33H44N6O5/c1-22(2)18-26(37-33(44)39-16-10-4-5-11-17-39)30(40)35-27(19-23-21-38(3)29-14-7-6-13-25(23)29)31(41)36-28(32(42)43)20-24-12-8-9-15-34-24/h6-9,12-15,21-22,26-28H,4-5,10-11,16-20H2,1-3H3,(H,35,40)(H,36,41)(H,37,44)(H,42,43)	LIOKMIQQPDDTNO-UHFFFAOYSA-N	50286804	(R)-2-[(R)-2-{(S)-2-[(Azepane-1-carbonyl)-amino]-4-methyl-pentanoylamino}-3-(1-methyl-1H-indol-3-yl)-propionylamino]-3-pyridin-2-yl-propionic acid::CHEMBL352396	Endothelin-1 receptor	Homo sapiens	 0.800000								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50286804	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50286804&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			107810	104128375		CHEMBL352396					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624415	CC(C)(C)c1ccc(cc1)S(=O)(=O)Nc2c(c(nc(n2)c3ncccn3)OCCO)Oc4ccccc4OC	InChI=1S/C27H29N5O6S/c1-27(2,3)18-10-12-19(13-11-18)39(34,35)32-23-22(38-21-9-6-5-8-20(21)36-4)26(37-17-16-33)31-25(30-23)24-28-14-7-15-29-24/h5-15,33H,16-17H2,1-4H3,(H,30,31,32)	GJPICJJJRGTNOD-UHFFFAOYSA-N	50061101	4-tert-butyl-N-[6-(2-hydroxyethoxy)-5-(2-methoxyphenoxy)-2,2'-bipyrimidin-4-yl]benzenesulfonamide::CHEMBL957::4-(1,1-Dimethylethyl)-N-(6-(2-hydroxyethoxy)-5-(2-methoxyphenoxy)-(2,2'-bipyrimidin)-4-yl) benzenesulfornamide::p-tert-Butyl-N-(6-(2-hydroxyethoxy)-5-(o-methoxyphenoxy)-2-(2-pyrimidinyl)-4-pyrimidinyl)benzenesulfonamide::BOSENTAN	Endothelin-1 receptor	Homo sapiens	 3.7								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50061101	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50061101&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	K86	5XPR	104865	103956688		CHEMBL957	DB00559				1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624416	CCCc1cc(ccc1OC(C(=O)NS(=O)(=O)c1ccc(cc1)C(C)C)c1ccc2OCOc2c1)C(O)=O	InChI=1S/C28H29NO8S/c1-4-5-19-14-21(28(31)32)9-12-23(19)37-26(20-8-13-24-25(15-20)36-16-35-24)27(30)29-38(33,34)22-10-6-18(7-11-22)17(2)3/h6-15,17,26H,4-5,16H2,1-3H3,(H,29,30)(H,31,32)	JPPYWKVKLSBQJM-UHFFFAOYSA-N	50050964	L-754142::4-[1-Benzo[1,3]dioxol-5-yl-2-(4-isopropyl-benzenesulfonylamino)-2-oxo-ethoxy]-3-propyl-benzoic acid::CHEMBL8978	Endothelin-1 receptor	Homo sapiens	 34								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050964	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050964&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			9894460	103948055		CHEMBL8978					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624417	CCCCN(CCCC)C(=O)CN1[C@H](c2cc(OC)c3c(c2)OCO3)C[C@@H](C(=O)O)[C@@H]1CC(C)(C)CCC	InChI=1S/C30H48N2O6/c1-7-10-13-31(14-11-8-2)27(33)19-32-23(21-15-25(36-6)28-26(16-21)37-20-38-28)17-22(29(34)35)24(32)18-30(4,5)12-9-3/h15-16,22-24H,7-14,17-20H2,1-6H3,(H,34,35)	JOFNRKXHKKTQIC-UHFFFAOYSA-N	50652928	CHEMBL5687007	Endothelin receptor type B	Human	 13000								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50652928	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50652928&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			177372766	519645198							1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51624418	CC(C)(C)c1ccc(cc1)S(=O)(=O)Nc2c(c(nc(n2)c3ncccn3)OCCO)Oc4ccccc4OC	InChI=1S/C27H29N5O6S/c1-27(2,3)18-10-12-19(13-11-18)39(34,35)32-23-22(38-21-9-6-5-8-20(21)36-4)26(37-17-16-33)31-25(30-23)24-28-14-7-15-29-24/h5-15,33H,16-17H2,1-4H3,(H,30,31,32)	GJPICJJJRGTNOD-UHFFFAOYSA-N	50061101	4-tert-butyl-N-[6-(2-hydroxyethoxy)-5-(2-methoxyphenoxy)-2,2'-bipyrimidin-4-yl]benzenesulfonamide::CHEMBL957::4-(1,1-Dimethylethyl)-N-(6-(2-hydroxyethoxy)-5-(2-methoxyphenoxy)-(2,2'-bipyrimidin)-4-yl) benzenesulfornamide::p-tert-Butyl-N-(6-(2-hydroxyethoxy)-5-(o-methoxyphenoxy)-2-(2-pyrimidinyl)-4-pyrimidinyl)benzenesulfonamide::BOSENTAN	Endothelin receptor type B	Homo sapiens	 423								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50061101	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50061101&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	K86	5XPR	104865	103956688		CHEMBL957	DB00559				1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3						
51624419	CCCc1cc(ccc1OC(C(=O)NS(=O)(=O)c1ccc(cc1)C(C)C)c1ccc2OCOc2c1)C(O)=O	InChI=1S/C28H29NO8S/c1-4-5-19-14-21(28(31)32)9-12-23(19)37-26(20-8-13-24-25(15-20)36-16-35-24)27(30)29-38(33,34)22-10-6-18(7-11-22)17(2)3/h6-15,17,26H,4-5,16H2,1-3H3,(H,29,30)(H,31,32)	JPPYWKVKLSBQJM-UHFFFAOYSA-N	50050964	L-754142::4-[1-Benzo[1,3]dioxol-5-yl-2-(4-isopropyl-benzenesulfonylamino)-2-oxo-ethoxy]-3-propyl-benzoic acid::CHEMBL8978	Endothelin receptor type B	Homo sapiens	 1418								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050964	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050964&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			9894460	103948055		CHEMBL8978					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3						
51624420	COc1ccc(cc1)C(=O)C(\Cc1cc(OC)c(OC)c(OC)c1)=C(/C([O-])=O)c1ccc2OCOc2c1	InChI=1S/C28H26O9/c1-32-19-8-5-17(6-9-19)26(29)20(11-16-12-23(33-2)27(35-4)24(13-16)34-3)25(28(30)31)18-7-10-21-22(14-18)37-15-36-21/h5-10,12-14H,11,15H2,1-4H3,(H,30,31)/p-1	OFCTYBMKKTVKCR-UHFFFAOYSA-M	50034263	PD-156707::Sodium; (Z)-2-benzo[1,3]dioxol-5-yl-4-(4-methoxy-phenyl)-4-oxo-3-(3,4,5-trimethoxy-benzyl)-but-2-enoate::CHEMBL25438	Endothelin-1 receptor	Homo sapiens	 0.170000								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50034263	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50034263&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			91929183	103942464		CHEMBL25438					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624421	CCCOc1ccc2[C@@H]([C@H]([C@@H](c2c1)c1ccc(OC)cc1OCCO)C(O)=O)c1ccc2OCOc2c1	InChI=1S/C29H30O8/c1-3-11-34-19-6-7-20-22(14-19)27(21-8-5-18(33-2)15-24(21)35-12-10-30)28(29(31)32)26(20)17-4-9-23-25(13-17)37-16-36-23/h4-9,13-15,26-28,30H,3,10-12,16H2,1-2H3,(H,31,32)	GLCKXJLCYIJMRB-UHFFFAOYSA-N	50061077	Enrasentan::SB 217242::(1S,2R,3S)-1-Benzo[1,3]dioxol-5-yl-3-[2-(2-hydroxy-ethoxy)-4-methoxy-phenyl]-5-propoxy-indan-2-carboxylic acid::CHEMBL431651::SB-217242	Endothelin-1 receptor	Homo sapiens	 1.1								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50061077	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50061077&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			178103	103956664		CHEMBL431651					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624422	CC(C)C[C@H](NC(=O)N1CCCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)C(=O)N[C@H](Cc1ccccn1)C(O)=O	InChI=1S/C33H44N6O5/c1-22(2)18-26(37-33(44)39-16-10-4-5-11-17-39)30(40)35-27(19-23-21-38(3)29-14-7-6-13-25(23)29)31(41)36-28(32(42)43)20-24-12-8-9-15-34-24/h6-9,12-15,21-22,26-28H,4-5,10-11,16-20H2,1-3H3,(H,35,40)(H,36,41)(H,37,44)(H,42,43)	LIOKMIQQPDDTNO-UHFFFAOYSA-N	50286804	(R)-2-[(R)-2-{(S)-2-[(Azepane-1-carbonyl)-amino]-4-methyl-pentanoylamino}-3-(1-methyl-1H-indol-3-yl)-propionylamino]-3-pyridin-2-yl-propionic acid::CHEMBL352396	Endothelin-1 receptor	Homo sapiens	 1.000000								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50286804	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50286804&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			107810	104128375		CHEMBL352396					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624423	COc1ccccc1Oc1c(NS(=O)(=O)c2ccc(C)cn2)nc(nc1OCCO)-c1ccnc(c1)-c1nnn[nH]1	InChI=1S/C25H23N9O6S/c1-15-7-8-20(27-14-15)41(36,37)32-24-21(40-19-6-4-3-5-18(19)38-2)25(39-12-11-35)29-22(28-24)16-9-10-26-17(13-16)23-30-33-34-31-23/h3-10,13-14,35H,11-12H2,1-2H3,(H,28,29,32)(H,30,31,33,34)	LFWCJABOXHSRGC-UHFFFAOYSA-N	50066370	5-Methyl-pyridine-2-sulfonic acid {6-(2-hydroxy-ethoxy)-5-(2-methoxy-phenoxy)-2-[2-(2H-tetrazol-5-yl)-pyridin-4-yl]-pyrimidin-4-yl}-amide::clazosentan::CHEMBL109648	Endothelin-1 receptor	Homo sapiens	 0.130000								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50066370	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50066370&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			6433095	103961012		CHEMBL109648					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624424	CC(C)C[C@@H]1NC(=O)[C@H](c2cccs2)NC(=O)[C@H](CC(=O)[O-])NC(=O)[C@H](CC(=O)N2CCN(c3ccccc3)CC2)NC(=O)[C@@H](CC(=O)[O-])NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC1=O	InChI=1S/C45H53N9O11S/c1-25(2)19-30-40(60)47-31(20-26-24-46-29-12-7-6-11-28(26)29)41(61)49-33(22-37(56)57)43(63)48-32(21-36(55)54-16-14-53(15-17-54)27-9-4-3-5-10-27)42(62)50-34(23-38(58)59)44(64)52-39(45(65)51-30)35-13-8-18-66-35/h3-13,18,24-25,30-34,39,46H,14-17,19-23H2,1-2H3,(H,47,60)(H,48,63)(H,49,61)(H,50,62)(H,51,65)(H,52,64)(H,56,57)(H,58,59)/p-2	HAHANBGRLRTDGL-UHFFFAOYSA-L	50652929	CHEMBL5687016	Endothelin-1 receptor	Human	 1.3								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50652929	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50652929&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			177372767	519645199							1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51624425	COc1cc(OC)nc(O[C@@H](C(=O)O)C(OC)(c2ccccc2)c2ccccc2)n1	InChI=1S/C22H22N2O6/c1-27-17-14-18(28-2)24-21(23-17)30-19(20(25)26)22(29-3,15-10-6-4-7-11-15)16-12-8-5-9-13-16/h4-14,19H,1-3H3,(H,25,26)	FEJVSJIALLTFRP-UHFFFAOYSA-N	50652930	CHEMBL5687038	Endothelin-1 receptor	Human	 6.0								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50652930	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50652930&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			9931375	519645200							1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51624426	CC(C)(C)c1ccc(cc1)S(=O)(=O)Nc2c(c(nc(n2)c3ncccn3)OCCO)Oc4ccccc4OC	InChI=1S/C27H29N5O6S/c1-27(2,3)18-10-12-19(13-11-18)39(34,35)32-23-22(38-21-9-6-5-8-20(21)36-4)26(37-17-16-33)31-25(30-23)24-28-14-7-15-29-24/h5-15,33H,16-17H2,1-4H3,(H,30,31,32)	GJPICJJJRGTNOD-UHFFFAOYSA-N	50061101	4-tert-butyl-N-[6-(2-hydroxyethoxy)-5-(2-methoxyphenoxy)-2,2'-bipyrimidin-4-yl]benzenesulfonamide::CHEMBL957::4-(1,1-Dimethylethyl)-N-(6-(2-hydroxyethoxy)-5-(2-methoxyphenoxy)-(2,2'-bipyrimidin)-4-yl) benzenesulfornamide::p-tert-Butyl-N-(6-(2-hydroxyethoxy)-5-(o-methoxyphenoxy)-2-(2-pyrimidinyl)-4-pyrimidinyl)benzenesulfonamide::BOSENTAN	Endothelin-1 receptor	Homo sapiens	 6.5								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50061101	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50061101&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	K86	5XPR	104865	103956688		CHEMBL957	DB00559				1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624427	CCCc1cc(ccc1OC(C(=O)NS(=O)(=O)c1ccc(cc1)C(C)C)c1ccc2OCOc2c1)C(O)=O	InChI=1S/C28H29NO8S/c1-4-5-19-14-21(28(31)32)9-12-23(19)37-26(20-8-13-24-25(15-20)36-16-35-24)27(30)29-38(33,34)22-10-6-18(7-11-22)17(2)3/h6-15,17,26H,4-5,16H2,1-3H3,(H,29,30)(H,31,32)	JPPYWKVKLSBQJM-UHFFFAOYSA-N	50050964	L-754142::4-[1-Benzo[1,3]dioxol-5-yl-2-(4-isopropyl-benzenesulfonylamino)-2-oxo-ethoxy]-3-propyl-benzoic acid::CHEMBL8978	Endothelin-1 receptor	Homo sapiens	 0.130000								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050964	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050964&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			9894460	103948055		CHEMBL8978					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624428	COc1ccc(cc1)C(=O)C(\Cc1cc(OC)c(OC)c(OC)c1)=C(/C([O-])=O)c1ccc2OCOc2c1	InChI=1S/C28H26O9/c1-32-19-8-5-17(6-9-19)26(29)20(11-16-12-23(33-2)27(35-4)24(13-16)34-3)25(28(30)31)18-7-10-21-22(14-18)37-15-36-21/h5-10,12-14H,11,15H2,1-4H3,(H,30,31)/p-1	OFCTYBMKKTVKCR-UHFFFAOYSA-M	50034263	PD-156707::Sodium; (Z)-2-benzo[1,3]dioxol-5-yl-4-(4-methoxy-phenyl)-4-oxo-3-(3,4,5-trimethoxy-benzyl)-but-2-enoate::CHEMBL25438	Endothelin receptor type B	Homo sapiens	 139								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50034263	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50034263&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			91929183	103942464		CHEMBL25438					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3						
51624429	CC(C)C[C@H](NC(=O)N1CCCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)C(=O)N[C@H](Cc1ccccn1)C(O)=O	InChI=1S/C33H44N6O5/c1-22(2)18-26(37-33(44)39-16-10-4-5-11-17-39)30(40)35-27(19-23-21-38(3)29-14-7-6-13-25(23)29)31(41)36-28(32(42)43)20-24-12-8-9-15-34-24/h6-9,12-15,21-22,26-28H,4-5,10-11,16-20H2,1-3H3,(H,35,40)(H,36,41)(H,37,44)(H,42,43)	LIOKMIQQPDDTNO-UHFFFAOYSA-N	50286804	(R)-2-[(R)-2-{(S)-2-[(Azepane-1-carbonyl)-amino]-4-methyl-pentanoylamino}-3-(1-methyl-1H-indol-3-yl)-propionylamino]-3-pyridin-2-yl-propionic acid::CHEMBL352396	Endothelin receptor type B	Homo sapiens	 7300								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50286804	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50286804&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			107810	104128375		CHEMBL352396					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3						
51624430	CCCOc1ccc2[C@@H]([C@H]([C@@H](c2c1)c1ccc(OC)cc1OCCO)C(O)=O)c1ccc2OCOc2c1	InChI=1S/C29H30O8/c1-3-11-34-19-6-7-20-22(14-19)27(21-8-5-18(33-2)15-24(21)35-12-10-30)28(29(31)32)26(20)17-4-9-23-25(13-17)37-16-36-23/h4-9,13-15,26-28,30H,3,10-12,16H2,1-2H3,(H,31,32)	GLCKXJLCYIJMRB-UHFFFAOYSA-N	50061077	Enrasentan::SB 217242::(1S,2R,3S)-1-Benzo[1,3]dioxol-5-yl-3-[2-(2-hydroxy-ethoxy)-4-methoxy-phenyl]-5-propoxy-indan-2-carboxylic acid::CHEMBL431651::SB-217242	Endothelin receptor type B	Homo sapiens	 111								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50061077	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50061077&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			178103	103956664		CHEMBL431651					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3						
51624431	COc1ccccc1Oc1c(NS(=O)(=O)c2ccc(C)cn2)nc(nc1OCCO)-c1ccnc(c1)-c1nnn[nH]1	InChI=1S/C25H23N9O6S/c1-15-7-8-20(27-14-15)41(36,37)32-24-21(40-19-6-4-3-5-18(19)38-2)25(39-12-11-35)29-22(28-24)16-9-10-26-17(13-16)23-30-33-34-31-23/h3-10,13-14,35H,11-12H2,1-2H3,(H,28,29,32)(H,30,31,33,34)	LFWCJABOXHSRGC-UHFFFAOYSA-N	50066370	5-Methyl-pyridine-2-sulfonic acid {6-(2-hydroxy-ethoxy)-5-(2-methoxy-phenoxy)-2-[2-(2H-tetrazol-5-yl)-pyridin-4-yl]-pyrimidin-4-yl}-amide::clazosentan::CHEMBL109648	Endothelin receptor type B	Homo sapiens	>130								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50066370	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50066370&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			6433095	103961012		CHEMBL109648					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3						
51624432	CC(C)C[C@@H]1NC(=O)[C@H](c2cccs2)NC(=O)[C@H](CC(=O)[O-])NC(=O)[C@H](CC(=O)N2CCN(c3ccccc3)CC2)NC(=O)[C@@H](CC(=O)[O-])NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC1=O	InChI=1S/C45H53N9O11S/c1-25(2)19-30-40(60)47-31(20-26-24-46-29-12-7-6-11-28(26)29)41(61)49-33(22-37(56)57)43(63)48-32(21-36(55)54-16-14-53(15-17-54)27-9-4-3-5-10-27)42(62)50-34(23-38(58)59)44(64)52-39(45(65)51-30)35-13-8-18-66-35/h3-13,18,24-25,30-34,39,46H,14-17,19-23H2,1-2H3,(H,47,60)(H,48,63)(H,49,61)(H,50,62)(H,51,65)(H,52,64)(H,56,57)(H,58,59)/p-2	HAHANBGRLRTDGL-UHFFFAOYSA-L	50652929	CHEMBL5687016	Endothelin receptor type B	Human	 590								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50652929	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50652929&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			177372767	519645199							1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51624433	COc1cc(OC)nc(O[C@@H](C(=O)O)C(OC)(c2ccccc2)c2ccccc2)n1	InChI=1S/C22H22N2O6/c1-27-17-14-18(28-2)24-21(23-17)30-19(20(25)26)22(29-3,15-10-6-4-7-11-15)16-12-8-5-9-13-16/h4-14,19H,1-3H3,(H,25,26)	FEJVSJIALLTFRP-UHFFFAOYSA-N	50652930	CHEMBL5687038	Endothelin receptor type B	Human	 960								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50652930	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50652930&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			9931375	519645200							1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51624434	CC(C)(C)c1ccc(cc1)S(=O)(=O)Nc2c(c(nc(n2)c3ncccn3)OCCO)Oc4ccccc4OC	InChI=1S/C27H29N5O6S/c1-27(2,3)18-10-12-19(13-11-18)39(34,35)32-23-22(38-21-9-6-5-8-20(21)36-4)26(37-17-16-33)31-25(30-23)24-28-14-7-15-29-24/h5-15,33H,16-17H2,1-4H3,(H,30,31,32)	GJPICJJJRGTNOD-UHFFFAOYSA-N	50061101	4-tert-butyl-N-[6-(2-hydroxyethoxy)-5-(2-methoxyphenoxy)-2,2'-bipyrimidin-4-yl]benzenesulfonamide::CHEMBL957::4-(1,1-Dimethylethyl)-N-(6-(2-hydroxyethoxy)-5-(2-methoxyphenoxy)-(2,2'-bipyrimidin)-4-yl) benzenesulfornamide::p-tert-Butyl-N-(6-(2-hydroxyethoxy)-5-(o-methoxyphenoxy)-2-(2-pyrimidinyl)-4-pyrimidinyl)benzenesulfonamide::BOSENTAN	Endothelin receptor type B	Homo sapiens	 343								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50061101	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50061101&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	K86	5XPR	104865	103956688		CHEMBL957	DB00559				1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3						
51624435	CCCc1cc(ccc1OC(C(=O)NS(=O)(=O)c1ccc(cc1)C(C)C)c1ccc2OCOc2c1)C(O)=O	InChI=1S/C28H29NO8S/c1-4-5-19-14-21(28(31)32)9-12-23(19)37-26(20-8-13-24-25(15-20)36-16-35-24)27(30)29-38(33,34)22-10-6-18(7-11-22)17(2)3/h6-15,17,26H,4-5,16H2,1-3H3,(H,29,30)(H,31,32)	JPPYWKVKLSBQJM-UHFFFAOYSA-N	50050964	L-754142::4-[1-Benzo[1,3]dioxol-5-yl-2-(4-isopropyl-benzenesulfonylamino)-2-oxo-ethoxy]-3-propyl-benzoic acid::CHEMBL8978	Endothelin receptor type B	Homo sapiens	 5.4								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050964	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050964&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			9894460	103948055		CHEMBL8978					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3						
51624436	Cc1noc(NS(=O)(=O)c2ccsc2C(=O)Cc2cc3OCOc3cc2C)c1Cl	InChI=1S/C18H15ClN2O6S2/c1-9-5-13-14(26-8-25-13)7-11(9)6-12(22)17-15(3-4-28-17)29(23,24)21-18-16(19)10(2)20-27-18/h3-5,7,21H,6,8H2,1-2H3	PHWXUGHIIBDVKD-UHFFFAOYSA-N	50058126	2-{[3-(4-Chloro-3-methyl-isoxazol-5-ylsulfamoyl)-thiophene-2-carbonyl]-amino}-5-methyl-benzoic acid isopropyl ester::Sitaxentan::2-[2-(6-Methyl-benzo[1,3]dioxol-5-yl)-acetyl]-thiophene-3-sulfonic acid (4-chloro-3-methyl-isoxazol-5-yl)-amide::2-[2-(6-Methyl-benzo[1,3]dioxol-5-yl)-acetyl]-thiophene-3-sulfonic acid (4-chloro-3-methyl-isoxazol-5-yl)-amide (Sitaxsentan)::CHEMBL282724	Endothelin-1 receptor	Homo sapiens	 0.430000								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50058126	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50058126&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			216235	103954105		CHEMBL282724	DB06268				1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624437	CCCOc1ccc2[C@@H]([C@H]([C@@H](c2c1)c1ccc(OC)cc1OCC(O)=O)C(O)=O)c1ccc2OCOc2c1	InChI=1S/C29H28O9/c1-3-10-35-18-6-7-19-21(12-18)27(20-8-5-17(34-2)13-23(20)36-14-25(30)31)28(29(32)33)26(19)16-4-9-22-24(11-16)38-15-37-22/h4-9,11-13,26-28H,3,10,14-15H2,1-2H3,(H,30,31)(H,32,33)	UUAVCCWBNUITBB-UHFFFAOYSA-N	50041617	(1S,2R,3S)-1-Benzo[1,3]dioxol-5-yl-3-(2-carboxymethoxy-4-methoxy-phenyl)-5-propoxy-indan-2-carboxylic acid::1-benzo[d][1,3]dioxol-5-ylmethyl-3-(2-carboxymethoxy-4-methoxyphenyl)-5-propoxy-(1R,3S)-2,3-dihydro-1H-2-indenecarboxylic acid::SB 209670::CHEMBL8823::SB-209670	Endothelin-1 receptor	Homo sapiens	 0.200000								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50041617	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50041617&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			108002	103973307		CHEMBL8823					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2						
51624438	CCCOc1ccc2[C@@H]([C@H]([C@@H](c2c1)c1ccc(OC)cc1OCC(O)=O)C(O)=O)c1ccc2OCOc2c1	InChI=1S/C29H28O9/c1-3-10-35-18-6-7-19-21(12-18)27(20-8-5-17(34-2)13-23(20)36-14-25(30)31)28(29(32)33)26(19)16-4-9-22-24(11-16)38-15-37-22/h4-9,11-13,26-28H,3,10,14-15H2,1-2H3,(H,30,31)(H,32,33)	UUAVCCWBNUITBB-UHFFFAOYSA-N	50041617	(1S,2R,3S)-1-Benzo[1,3]dioxol-5-yl-3-(2-carboxymethoxy-4-methoxy-phenyl)-5-propoxy-indan-2-carboxylic acid::1-benzo[d][1,3]dioxol-5-ylmethyl-3-(2-carboxymethoxy-4-methoxyphenyl)-5-propoxy-(1R,3S)-2,3-dihydro-1H-2-indenecarboxylic acid::SB 209670::CHEMBL8823::SB-209670	Endothelin receptor type B	Homo sapiens	 18								ChEMBL		10.7270/Q2J96C49	10082200			Wu-Wong, JR; Dixon, DB; Chiou, WJ; Dayton, BD; Novosad, EI; Adler, AL; Wessale, JL; Calzadilla, SV; Hernandez, L; Marsh, KC; Liu, G; Szczepankiewicz, B; von Geldern, TW; Opgenorth, TJ	//0	10/13/2025	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50041617	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50041617&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			108002	103973307		CHEMBL8823					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3						
