BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50793074 Oc1ccc(\C=C\C(=O)OC2CCC(CC2)OC(=O)\C=C\c2ccc(O)c(O)c2)cc1O |(-2.66,-3.51,;-1.31,-4.26,;.02,-3.48,;1.36,-4.24,;1.36,-5.78,;2.7,-6.55,;4.03,-5.78,;5.38,-6.53,;5.39,-8.07,;6.71,-5.76,;8.26,-5.71,;9.06,-7.01,;10.6,-6.97,;11.34,-5.62,;10.53,-4.31,;8.99,-4.35,;12.88,-5.57,;14.22,-4.8,;14.22,-3.26,;15.56,-5.57,;16.89,-4.8,;18.22,-5.57,;18.22,-7.12,;19.56,-7.89,;20.9,-7.12,;22.24,-7.89,;20.89,-5.56,;22.22,-4.79,;19.56,-4.8,;.05,-6.57,;-1.3,-5.81,;-2.63,-6.6,)| InChI=1S/C24H24O8/c25-19-9-1-15(13-21(19)27)3-11-23(29)31-17-5-7-18(8-6-17)32-24(30)12-4-16-2-10-20(26)22(28)14-16/h1-4,9-14,17-18,25-28H,5-8H2 VOAUUKZREABUKK-UHFFFAOYSA-N 50073623 (E)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 4-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-cyclohexyl ester::CHEMBL149826 Integrase Human immunodeficiency virus 1 1030 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073623 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073623&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6475218 103966957 CHEMBL149826 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793076 Oc1ccc(\C=C/C(=O)OC2CCCCC2OC(=O)\C=C/c2ccc(O)c(O)c2)cc1O InChI=1S/C24H24O8/c25-17-9-5-15(13-19(17)27)7-11-23(29)31-21-3-1-2-4-22(21)32-24(30)12-8-16-6-10-18(26)20(28)14-16/h5-14,21-22,25-28H,1-4H2 ABRIKWKVYABQBU-UHFFFAOYSA-N 50073625 (Z)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 2-[(Z)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-cyclohexyl ester::CHEMBL149305 Integrase Human immunodeficiency virus 1 8360 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073625 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073625&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 44364977 103966959 CHEMBL149305 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793077 OC(=O)C(OC(=O)c1ccc(O)c(O)c1)C(OC(=O)c1ccc(O)c(O)c1)C(O)=O InChI=1S/C18H14O12/c19-9-3-1-7(5-11(9)21)17(27)29-13(15(23)24)14(16(25)26)30-18(28)8-2-4-10(20)12(22)6-8/h1-6,13-14,19-22H,(H,23,24)(H,25,26) LXHXLVFPIYKREW-UHFFFAOYSA-N 50073626 2,3-Bis-(3,4-dihydroxy-benzoyloxy)-succinic acid::CHEMBL415678 Integrase Human immunodeficiency virus 1 430 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073626 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073626&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 11510052 103966960 CHEMBL415678 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793078 O[C@@H]1C[C@](O)(CC(OC(=O)\C=C\c2ccc(O)c(O)c2)[C@@H]1OC(=O)\C=C\c1ccc(O)c(O)c1)C(O)=O InChI=1S/C25H24O12/c26-15-5-1-13(9-17(15)28)3-7-21(31)36-20-12-25(35,24(33)34)11-19(30)23(20)37-22(32)8-4-14-2-6-16(27)18(29)10-14/h1-10,19-20,23,26-30,35H,11-12H2,(H,33,34) UFCLZKMFXSILNL-UHFFFAOYSA-N 50073627 (1S,4R,5R)-3,4-Bis-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-1,5-dihydroxy-cyclohexanecarboxylic acid::CHEMBL149674 Integrase Human immunodeficiency virus 1 600 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073627 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073627&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6325421 103966961 CHEMBL149674 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793079 Oc1ccc(\C=C\C(=O)OCCOC(=O)\C=C\c2ccc(O)c(O)c2)cc1O InChI=1S/C20H18O8/c21-15-5-1-13(11-17(15)23)3-7-19(25)27-9-10-28-20(26)8-4-14-2-6-16(22)18(24)12-14/h1-8,11-12,21-24H,9-10H2 LTACDIIPISHXNX-UHFFFAOYSA-N 50073628 (E)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 2-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-ethyl ester::CHEMBL286477 Integrase Human immunodeficiency virus 1 >10000 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073628 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073628&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5470289 103966962 CHEMBL286477 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793080 OC(=O)C(OC(=O)c1cccc(O)c1O)C(OC(=O)c1cccc(O)c1O)C(O)=O InChI=1S/C18H14O12/c19-9-5-1-3-7(11(9)21)17(27)29-13(15(23)24)14(16(25)26)30-18(28)8-4-2-6-10(20)12(8)22/h1-6,13-14,19-22H,(H,23,24)(H,25,26) UPJSXAKGVMGIMQ-UHFFFAOYSA-N 50073629 2,3-Bis-(2,3-dihydroxy-benzoyloxy)-succinic acid::CHEMBL357831 Integrase Human immunodeficiency virus 1 1070 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073629 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073629&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 21147023 103966963 CHEMBL357831 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793081 OC(=O)C(OC(=O)\C=C\c1ccc(O)c(O)c1)C(OC(=O)\C=C\c1ccc(O)c(O)c1)C(O)=O InChI=1S/C22H18O12/c23-13-5-1-11(9-15(13)25)3-7-17(27)33-19(21(29)30)20(22(31)32)34-18(28)8-4-12-2-6-14(24)16(26)10-12/h1-10,19-20,23-26H,(H,29,30)(H,31,32) YDDGKXBLOXEEMN-UHFFFAOYSA-N 50073630 2,3-Bis-[3-(3,4-dihydroxy-phenyl)-acryloyloxy]-succinic acid::2,3-Bis-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-succinic acid::CHEMBL63592 Integrase Human immunodeficiency virus 1 80 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073630 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073630&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5315820 103966964 CHEMBL63592 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793082 Oc1ccc(\C=C/C(=O)OC2CCCC(C2)OC(=O)\C=C/c2ccc(O)c(O)c2)cc1O InChI=1S/C24H24O8/c25-19-8-4-15(12-21(19)27)6-10-23(29)31-17-2-1-3-18(14-17)32-24(30)11-7-16-5-9-20(26)22(28)13-16/h4-13,17-18,25-28H,1-3,14H2 HALOOJXOGWGVKR-UHFFFAOYSA-N 50073632 (Z)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 3-[(Z)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-cyclohexyl ester::CHEMBL440354 Integrase Human immunodeficiency virus 1 1630 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073632 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073632&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 44365293 103966966 CHEMBL440354 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793083 OC(=O)C(COC(=O)\C=C\c1ccc(O)c(O)c1)OC(=O)\C=C\c1ccc(O)c(O)c1 InChI=1S/C21H18O10/c22-14-5-1-12(9-16(14)24)3-7-19(26)30-11-18(21(28)29)31-20(27)8-4-13-2-6-15(23)17(25)10-13/h1-10,18,22-25H,11H2,(H,28,29) YEQHQUIPLHIYJE-UHFFFAOYSA-N 50073631 (E)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 1-carboxy-2-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-ethyl ester::CHEMBL30868 Integrase Human immunodeficiency virus 1 520 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073631 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073631&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5470546 103966965 CHEMBL30868 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793084 Oc1ccc(\C=C\C(=O)OC2CCCCC2OC(=O)\C=C\c2ccc(O)c(O)c2)cc1O InChI=1S/C24H24O8/c25-17-9-5-15(13-19(17)27)7-11-23(29)31-21-3-1-2-4-22(21)32-24(30)12-8-16-6-10-18(26)20(28)14-16/h5-14,21-22,25-28H,1-4H2 ABRIKWKVYABQBU-UHFFFAOYSA-N 50073633 (E)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 2-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-cyclohexyl ester::CHEMBL348709 Integrase Human immunodeficiency virus 1 >10000 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073633 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073633&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5934183 103966967 CHEMBL348709 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793085 OC(=O)C(OC(=O)c1cc(O)c(O)c(O)c1)C(OC(=O)c1cc(O)c(O)c(O)c1)C(O)=O InChI=1S/C18H14O14/c19-7-1-5(2-8(20)11(7)23)17(29)31-13(15(25)26)14(16(27)28)32-18(30)6-3-9(21)12(24)10(22)4-6/h1-4,13-14,19-24H,(H,25,26)(H,27,28) ISFQIUFDHRENTK-UHFFFAOYSA-N 50073634 2,3-Bis-(3,4,5-trihydroxy-benzoyloxy)-succinic acid::CHEMBL357646 Integrase Human immunodeficiency virus 1 970 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073634 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073634&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 10072649 103966968 CHEMBL357646 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793086 OC1C[C@@](O)(C[C@@H](OC(=O)\C=C\c2ccc(O)c(O)c2)[C@H]1OC(=O)\C=C\c1ccc(O)c(O)c1)C(O)=O InChI=1S/C25H24O12/c26-15-5-1-13(9-17(15)28)3-7-21(31)36-20-12-25(35,24(33)34)11-19(30)23(20)37-22(32)8-4-14-2-6-16(27)18(29)10-14/h1-10,19-20,23,26-30,35H,11-12H2,(H,33,34) UFCLZKMFXSILNL-UHFFFAOYSA-N 50073635 (1R,3R,4S)-3,4-Bis-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-1,5-dihydroxy-cyclohexanecarboxylic acid::CHEMBL358821 Integrase Human immunodeficiency virus 1 1400 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073635 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073635&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 10207978 103966969 CHEMBL358821 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793087 OC(=O)c1cc(OC(=O)\C=C\c2ccc(O)c(O)c2)cc(OC(=O)\C=C\c2ccc(O)c(O)c2)c1 InChI=1S/C25H18O10/c26-19-5-1-14(9-21(19)28)3-7-23(30)34-17-11-16(25(32)33)12-18(13-17)35-24(31)8-4-15-2-6-20(27)22(29)10-15/h1-13,26-29H,(H,32,33) SXLGXPZQECDQIF-UHFFFAOYSA-N 50073637 3,5-Bis-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-benzoic acid::CHEMBL146179 Integrase Human immunodeficiency virus 1 6900 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073637 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073637&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474639 103966971 CHEMBL146179 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793088 OC(=O)C(OC(=O)\C=C\c1ccc(O)c(O)c1)C(OC(=O)\C=C\c1ccc(O)c(O)c1)C(O)=O InChI=1S/C22H18O12/c23-13-5-1-11(9-15(13)25)3-7-17(27)33-19(21(29)30)20(22(31)32)34-18(28)8-4-12-2-6-14(24)16(26)10-12/h1-10,19-20,23-26H,(H,29,30)(H,31,32) YDDGKXBLOXEEMN-UHFFFAOYSA-N 50073630 2,3-Bis-[3-(3,4-dihydroxy-phenyl)-acryloyloxy]-succinic acid::2,3-Bis-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-succinic acid::CHEMBL63592 Integrase Human immunodeficiency virus 1 80.0 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073630 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073630&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5315820 103966964 CHEMBL63592 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793089 OC(=O)C(OC(=O)Cc1ccc(O)c(O)c1)C(OC(=O)Cc1ccc(O)c(O)c1)C(O)=O InChI=1S/C20H18O12/c21-11-3-1-9(5-13(11)23)7-15(25)31-17(19(27)28)18(20(29)30)32-16(26)8-10-2-4-12(22)14(24)6-10/h1-6,17-18,21-24H,7-8H2,(H,27,28)(H,29,30) HLHYYKPOHCCJGX-UHFFFAOYSA-N 50073638 2,3-Bis-[2-(3,4-dihydroxy-phenyl)-acetoxy]-succinic acid::CHEMBL148364 Integrase Human immunodeficiency virus 1 880 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073638 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073638&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 11648080 103966972 CHEMBL148364 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793090 Oc1ccc(\C=C\C(=O)OCCCOC(=O)\C=C\c2ccc(O)c(O)c2)cc1O InChI=1S/C21H20O8/c22-16-6-2-14(12-18(16)24)4-8-20(26)28-10-1-11-29-21(27)9-5-15-3-7-17(23)19(25)13-15/h2-9,12-13,22-25H,1,10-11H2 QUBPJJHCAOTXEB-UHFFFAOYSA-N 50073636 (E)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 3-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-propyl ester::CHEMBL31026 Integrase Human immunodeficiency virus 1 >10000 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073636 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073636&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5470295 103966970 CHEMBL31026 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793091 OC(=O)[C@@H](OC(=O)\C=C\c1ccc(O)c(O)c1)[C@H](OC(=O)\C=C\c1ccc(O)c(O)c1)C(O)=O |r| InChI=1S/C22H18O12/c23-13-5-1-11(9-15(13)25)3-7-17(27)33-19(21(29)30)20(22(31)32)34-18(28)8-4-12-2-6-14(24)16(26)10-12/h1-10,19-20,23-26H,(H,29,30)(H,31,32) YDDGKXBLOXEEMN-UHFFFAOYSA-N 50076267 chicoric acid::D-chicoric acid::(2S,3S)-2,3-Bis-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-succinic acid::CHEMBL29660 Integrase Human immunodeficiency virus 1 70 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50076267 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50076267&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5470299 103969200 CHEMBL29660 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793092 OC(=O)C(OC(=O)CCc1ccc(O)c(O)c1)C(OC(=O)CCc1ccc(O)c(O)c1)C(O)=O InChI=1S/C22H22O12/c23-13-5-1-11(9-15(13)25)3-7-17(27)33-19(21(29)30)20(22(31)32)34-18(28)8-4-12-2-6-14(24)16(26)10-12/h1-2,5-6,9-10,19-20,23-26H,3-4,7-8H2,(H,29,30)(H,31,32) LSABLHXNDXJOIS-UHFFFAOYSA-N 50073640 2,3-Bis-[3-(3,4-dihydroxy-phenyl)-propionyloxy]-succinic acid::CHEMBL149475 Integrase Human immunodeficiency virus 1 2380 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073640 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073640&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 9934778 103966974 CHEMBL149475 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793093 Oc1ccc(\C=C\C(=O)OC2CCCC(C2)OC(=O)\C=C\c2ccc(O)c(O)c2)cc1O InChI=1S/C24H24O8/c25-19-8-4-15(12-21(19)27)6-10-23(29)31-17-2-1-3-18(14-17)32-24(30)11-7-16-5-9-20(26)22(28)13-16/h4-13,17-18,25-28H,1-3,14H2 HALOOJXOGWGVKR-UHFFFAOYSA-N 50073639 (E)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 3-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-cyclohexyl ester::CHEMBL149178 Integrase Human immunodeficiency virus 1 1800 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073639 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073639&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 44365069 103966973 CHEMBL149178 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793094 Oc1ccc(\C=C\C(=O)OCCCCOC(=O)\C=C\c2ccc(O)c(O)c2)cc1O InChI=1S/C22H22O8/c23-17-7-3-15(13-19(17)25)5-9-21(27)29-11-1-2-12-30-22(28)10-6-16-4-8-18(24)20(26)14-16/h3-10,13-14,23-26H,1-2,11-12H2 FHYHSSSYAYUMJH-UHFFFAOYSA-N 50073641 (E)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 4-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-butyl ester::CHEMBL149306 Integrase Human immunodeficiency virus 1 >10000 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073641 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073641&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6477161 103966975 CHEMBL149306 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793095 Oc1ccc(\C=C/C(=O)OC2CCC(CC2)OC(=O)\C=C/c2ccc(O)c(O)c2)cc1O |(2.82,-12.69,;2.78,-11.15,;4.09,-10.34,;4.04,-8.83,;2.71,-8.06,;2.69,-6.54,;4.02,-5.76,;5.37,-6.52,;5.37,-8.06,;6.7,-5.75,;8.24,-5.69,;9.04,-7,;10.58,-6.95,;11.32,-5.61,;10.51,-4.3,;8.97,-4.34,;12.86,-5.56,;14.19,-4.79,;14.19,-3.25,;15.52,-5.56,;16.85,-4.79,;16.85,-3.25,;18.2,-2.48,;18.2,-.94,;16.85,-.17,;16.85,1.37,;15.52,-.96,;14.19,-.17,;15.52,-2.48,;1.38,-8.87,;1.42,-10.41,;.1,-11.21,)| InChI=1S/C24H24O8/c25-19-9-1-15(13-21(19)27)3-11-23(29)31-17-5-7-18(8-6-17)32-24(30)12-4-16-2-10-20(26)22(28)14-16/h1-4,9-14,17-18,25-28H,5-8H2 VOAUUKZREABUKK-UHFFFAOYSA-N 50073642 (Z)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 4-[(Z)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-cyclohexyl ester::CHEMBL146489 Integrase Human immunodeficiency virus 1 1010 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073642 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073642&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 44364827 103966976 CHEMBL146489 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793096 COC(=O)O[C@@]1(CC(OC(=O)\C=C\c2ccc(O)c(O)c2)[C@H](O)[C@@H](C1)OC(=O)\C=C\c1ccc(O)c(O)c1)C(O)=O InChI=1S/C27H26O14/c1-38-26(37)41-27(25(35)36)12-20(39-22(32)8-4-14-2-6-16(28)18(30)10-14)24(34)21(13-27)40-23(33)9-5-15-3-7-17(29)19(31)11-15/h2-11,20-21,24,28-31,34H,12-13H2,1H3,(H,35,36) VCDCQVDTYXJKOP-UHFFFAOYSA-N 50073643 (1R,3R,4S)-3,5-Bis-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-4-hydroxy-1-methoxycarbonyloxy-cyclohexanecarboxylic acid::CHEMBL149893 Integrase Human immunodeficiency virus 1 800 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50073643 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50073643&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 44364943 103966977 CHEMBL149893 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50793097 O[C@@H]1C[C@](C[C@@H](OC(=O)\C=C\c2ccc(O)c(O)c2)[C@H]1O)(OC(=O)\C=C\c1ccc(O)c(O)c1)C(O)=O |r| InChI=1S/C25H24O12/c26-15-5-1-13(9-17(15)28)3-7-21(31)36-20-12-25(24(34)35,11-19(30)23(20)33)37-22(32)8-4-14-2-6-16(27)18(29)10-14/h1-10,19-20,23,26-30,33H,11-12H2,(H,34,35) YDDUMTOHNYZQPO-UHFFFAOYSA-N 50369484 CYNARIN Integrase Human immunodeficiency virus 1 1600 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50369484 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50369484&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5281769 160848586 C10445 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 51032671 O[C@H]1[C@@H](C[C@@](O)(C[C@H]1OC(=O)\C=C\c1ccc(O)c(O)c1)C(O)=O)OC(=O)\C=C\c1ccc(O)c(O)c1 |r,wU:2.25,4.22,wD:1.0,7.8,4.4,(-1.06,-23.53,;-1.06,-21.99,;.29,-21.22,;.29,-19.66,;-1.06,-18.89,;.22,-18.03,;-2.39,-19.66,;-2.39,-21.22,;-3.73,-21.99,;-3.73,-23.53,;-2.39,-24.3,;-5.06,-24.3,;-5.06,-25.84,;-6.39,-26.61,;-7.73,-25.84,;-9.06,-26.61,;-9.06,-28.15,;-10.39,-28.92,;-7.72,-28.92,;-7.71,-30.46,;-6.39,-28.15,;-1.91,-17.6,;-.95,-16.4,;-3.45,-17.53,;1.62,-21.99,;1.61,-23.53,;.28,-24.3,;2.95,-24.3,;2.94,-25.84,;4.27,-26.62,;4.26,-28.16,;5.59,-28.93,;6.93,-28.16,;8.26,-28.93,;6.93,-26.61,;8.26,-25.84,;5.6,-25.85,)| InChI=1S/C25H24O12/c26-15-5-1-13(9-17(15)28)3-7-21(30)36-19-11-25(35,24(33)34)12-20(23(19)32)37-22(31)8-4-14-2-6-16(27)18(29)10-14/h1-10,19-20,23,26-29,32,35H,11-12H2,(H,33,34) KRZBCHWVBQOTNZ-UHFFFAOYSA-N 50362839 CHEMBL249447 Integrase Human immunodeficiency virus 1 1300 ChEMBL 10.1021/jm9804735 10.7270/Q2G161J5 9986720 King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE 3/16/1999 11/13/2012 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50362839 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50362839&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474310 136966901 CHEMBL249447 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1