BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50054720 CSc1cc(C)nc(SC)c1NC(=O)N(CCc1ccccc1)Cc1ccc(Oc2ccc(F)cc2)cc1 InChI=1S/C30H30FN3O2S2/c1-21-19-27(37-2)28(29(32-21)38-3)33-30(35)34(18-17-22-7-5-4-6-8-22)20-23-9-13-25(14-10-23)36-26-15-11-24(31)12-16-26/h4-16,19H,17-18,20H2,1-3H3,(H,33,35) FYYJAFHMMHXLFL-UHFFFAOYSA-N 50067748 1-[4-(4-Fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-1-phenethyl-urea::CHEMBL138692 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 16 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067748 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067748&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10816431 103962174 CHEMBL138692 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054721 Cc1cc(C)c(NC(=O)N(Cc2ccc(Oc3ccc(F)cc3)cc2)C2CCCCCC2)c(C)n1 InChI=1S/C29H34FN3O2/c1-20-18-21(2)31-22(3)28(20)32-29(34)33(25-8-6-4-5-7-9-25)19-23-10-14-26(15-11-23)35-27-16-12-24(30)13-17-27/h10-18,25H,4-9,19H2,1-3H3,(H,32,34) XBHQAUGSXPGHKS-UHFFFAOYSA-N 50067763 1-Cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(2,4,6-trimethyl-pyridin-3-yl)-urea::CHEMBL344456 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 62 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067763 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067763&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 6918443 103962189 CHEMBL344456 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054722 CSc1cc(C)nc(SC)c1NC(=O)N(CCCc1ccccc1)Cc1ccc(Oc2ccc(F)cc2)cc1 InChI=1S/C31H32FN3O2S2/c1-22-20-28(38-2)29(30(33-22)39-3)34-31(36)35(19-7-10-23-8-5-4-6-9-23)21-24-11-15-26(16-12-24)37-27-17-13-25(32)14-18-27/h4-6,8-9,11-18,20H,7,10,19,21H2,1-3H3,(H,34,36) JQFWMZZARPYQRF-UHFFFAOYSA-N 50067764 1-[4-(4-Fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-1-(3-phenyl-propyl)-urea::CHEMBL343726 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 28 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067764 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067764&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10698136 103962190 CHEMBL343726 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054723 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccccc1)Cc1ccc(Oc2ccc(F)cc2)cc1 InChI=1S/C29H28FN3O2S2/c1-20-17-26(36-2)27(28(31-20)37-3)32-29(34)33(18-21-7-5-4-6-8-21)19-22-9-13-24(14-10-22)35-25-15-11-23(30)12-16-25/h4-17H,18-19H2,1-3H3,(H,32,34) ZAWDMDLGYKBJGO-UHFFFAOYSA-N 50067769 1-Benzyl-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-urea::CHEMBL140181 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 9.1 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067769 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067769&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10554300 103962195 CHEMBL140181 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054724 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1cccc(Oc2ccc(Br)cc2)c1)C1CCCCCC1 InChI=1S/C29H34BrN3O2S2/c1-20-17-26(36-2)27(28(31-20)37-3)32-29(34)33(23-10-6-4-5-7-11-23)19-21-9-8-12-25(18-21)35-24-15-13-22(30)14-16-24/h8-9,12-18,23H,4-7,10-11,19H2,1-3H3,(H,32,34) INIDDAFYUAWCQS-UHFFFAOYSA-N 50067751 1-[3-(4-Bromo-phenoxy)-benzyl]-1-cycloheptyl-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-urea::CHEMBL136230 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 73 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067751 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067751&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44358374 103962177 CHEMBL136230 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054725 CSc1nc(C)nc(SC)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCCCCC1 InChI=1S/C28H33FN4O2S2/c1-19-30-26(36-2)25(27(31-19)37-3)32-28(34)33(22-8-6-4-5-7-9-22)18-20-10-14-23(15-11-20)35-24-16-12-21(29)13-17-24/h10-17,22H,4-9,18H2,1-3H3,(H,32,34) MWJQAWUJZOLDCC-UHFFFAOYSA-N 50067755 1-Cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(2-methyl-4,6-bis-methylsulfanyl-pyrimidin-5-yl)-urea::CHEMBL134975 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 56 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067755 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067755&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 11800602 103962181 CHEMBL134975 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054726 CCOCCN(Cc1ccc(Oc2ccc(F)cc2)cc1)C(=O)Nc1c(SC)cc(C)nc1SC InChI=1S/C26H30FN3O3S2/c1-5-32-15-14-30(26(31)29-24-23(34-3)16-18(2)28-25(24)35-4)17-19-6-10-21(11-7-19)33-22-12-8-20(27)9-13-22/h6-13,16H,5,14-15,17H2,1-4H3,(H,29,31) CNBZNBZBZIXXFS-UHFFFAOYSA-N 50067768 1-(2-Ethoxy-ethyl)-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-urea::CHEMBL336223 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 24 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067768 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067768&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10529855 103962194 CHEMBL336223 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054727 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccc(Oc2ccc(Br)cc2)cc1)C1CCCCCC1 InChI=1S/C29H34BrN3O2S2/c1-20-18-26(36-2)27(28(31-20)37-3)32-29(34)33(23-8-6-4-5-7-9-23)19-21-10-14-24(15-11-21)35-25-16-12-22(30)13-17-25/h10-18,23H,4-9,19H2,1-3H3,(H,32,34) BTYYXVNJICACDP-UHFFFAOYSA-N 50067761 1-[4-(4-Bromo-phenoxy)-benzyl]-1-cycloheptyl-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-urea::CHEMBL342491 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 28 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067761 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067761&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10841273 103962187 CHEMBL342491 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054728 Fc1cc(F)c(NC(=O)N(Cc2ccccc2)Cc2cccc(c2)-c2cc[nH]n2)c(F)c1 InChI=1S/C24H19F3N4O/c25-19-12-20(26)23(21(27)13-19)29-24(32)31(14-16-5-2-1-3-6-16)15-17-7-4-8-18(11-17)22-9-10-28-30-22/h1-13H,14-15H2,(H,28,30)(H,29,32) GQGSSSROHBNTNO-UHFFFAOYSA-N 50065041 1-Benzyl-1-[3-(2H-pyrazol-3-yl)-benzyl]-3-(2,4,6-trifluoro-phenyl)-urea::FR-180734::CHEMBL78870 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 14 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065041 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065041&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 9954688 103959996 CHEMBL78870 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054729 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccccc1)Cc1ccc(Oc2ccc(Br)cc2)cc1 InChI=1S/C29H28BrN3O2S2/c1-20-17-26(36-2)27(28(31-20)37-3)32-29(34)33(18-21-7-5-4-6-8-21)19-22-9-13-24(14-10-22)35-25-15-11-23(30)12-16-25/h4-17H,18-19H2,1-3H3,(H,32,34) SJOOXFOOTSXQGS-UHFFFAOYSA-N 50067756 1-Benzyl-1-[4-(4-bromo-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-urea::CHEMBL336263 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 10 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067756 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067756&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10722197 103962182 CHEMBL336263 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054730 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCCCCC1 InChI=1S/C29H34FN3O2S2/c1-20-18-26(36-2)27(28(31-20)37-3)32-29(34)33(23-8-6-4-5-7-9-23)19-21-10-14-24(15-11-21)35-25-16-12-22(30)13-17-25/h10-18,23H,4-9,19H2,1-3H3,(H,32,34) VRCLMLMEOKXRHL-UHFFFAOYSA-N 50065027 1-Cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-urea::FR-182980::CHEMBL77842 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 30 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065027 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065027&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 9850220 103959982 CHEMBL77842 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054731 Cc1ccc(NC(=O)N(Cc2ccc(Oc3ccc(F)cc3)cc2)C2CCCCCC2)c(Cl)n1 InChI=1S/C27H29ClFN3O2/c1-19-8-17-25(26(28)30-19)31-27(33)32(22-6-4-2-3-5-7-22)18-20-9-13-23(14-10-20)34-24-15-11-21(29)12-16-24/h8-17,22H,2-7,18H2,1H3,(H,31,33) KUENKURAYPKJPO-UHFFFAOYSA-N 50067762 3-(2-Chloro-6-methyl-pyridin-3-yl)-1-cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-urea::CHEMBL136274 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 19 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067762 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067762&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10790945 103962188 CHEMBL136274 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054732 CSc1cc(C)nc(Cl)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCCCCC1 InChI=1S/C28H31ClFN3O2S/c1-19-17-25(36-2)26(27(29)31-19)32-28(34)33(22-7-5-3-4-6-8-22)18-20-9-13-23(14-10-20)35-24-15-11-21(30)12-16-24/h9-17,22H,3-8,18H2,1-2H3,(H,32,34) JXEWKNLTFYYEMH-UHFFFAOYSA-N 50067743 3-(2-Chloro-6-methyl-4-methylsulfanyl-pyridin-3-yl)-1-cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-urea::CHEMBL342476 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 46 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067743 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067743&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10720921 103962169 CHEMBL342476 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054733 CSc1cc(C)nc(c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCCCCC1)S(C)(=O)=O InChI=1S/C29H34FN3O4S2/c1-20-18-26(38-2)27(28(31-20)39(3,35)36)32-29(34)33(23-8-6-4-5-7-9-23)19-21-10-14-24(15-11-21)37-25-16-12-22(30)13-17-25/h10-18,23H,4-9,19H2,1-3H3,(H,32,34) ODCNUOQDHZTDEC-UHFFFAOYSA-N 50067747 1-Cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(2-methanesulfonyl-6-methyl-4-methylsulfanyl-pyridin-3-yl)-urea::CHEMBL136428 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 78 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067747 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067747&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10745661 103962173 CHEMBL136428 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054734 CSc1nc(C)cc(Cl)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCCCCC1 InChI=1S/C28H31ClFN3O2S/c1-19-17-25(29)26(27(31-19)36-2)32-28(34)33(22-7-5-3-4-6-8-22)18-20-9-13-23(14-10-20)35-24-15-11-21(30)12-16-24/h9-17,22H,3-8,18H2,1-2H3,(H,32,34) HWECDXFJBZZQTI-UHFFFAOYSA-N 50067746 3-(4-Chloro-6-methyl-2-methylsulfanyl-pyridin-3-yl)-1-cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-urea::CHEMBL344868 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 12 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067746 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067746&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10768496 103962172 CHEMBL344868 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054735 CSc1cc(C)nc(C)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCCCCC1 InChI=1S/C29H34FN3O2S/c1-20-18-27(36-3)28(21(2)31-20)32-29(34)33(24-8-6-4-5-7-9-24)19-22-10-14-25(15-11-22)35-26-16-12-23(30)13-17-26/h10-18,24H,4-9,19H2,1-3H3,(H,32,34) JDOAWEPQZNHSMC-UHFFFAOYSA-N 50067758 1-Cycloheptyl-3-(2,6-dimethyl-4-methylsulfanyl-pyridin-3-yl)-1-[4-(4-fluoro-phenoxy)-benzyl]-urea::CHEMBL139211 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 90 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067758 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067758&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10577551 103962184 CHEMBL139211 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054736 COc1nc(C)ccc1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCCCCC1 InChI=1S/C28H32FN3O3/c1-20-9-18-26(27(30-20)34-2)31-28(33)32(23-7-5-3-4-6-8-23)19-21-10-14-24(15-11-21)35-25-16-12-22(29)13-17-25/h9-18,23H,3-8,19H2,1-2H3,(H,31,33) OFJQEZNUPHKTNZ-UHFFFAOYSA-N 50067770 1-Cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(2-methoxy-6-methyl-pyridin-3-yl)-urea::CHEMBL265829 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 39 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067770 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067770&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10790795 103962196 CHEMBL265829 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054737 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C(C)(C)c1ccccc1 InChI=1S/C31H32FN3O2S2/c1-21-19-27(38-4)28(29(33-21)39-5)34-30(36)35(31(2,3)23-9-7-6-8-10-23)20-22-11-15-25(16-12-22)37-26-17-13-24(32)14-18-26/h6-19H,20H2,1-5H3,(H,34,36) DLMFWONBOLROSR-UHFFFAOYSA-N 50067752 1-[4-(4-Fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-1-(1-methyl-1-phenyl-ethyl)-urea::CHEMBL436603 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 24 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067752 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067752&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10793009 103962178 CHEMBL436603 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054739 COc1ccc(CN(Cc2ccc(Oc3ccc(F)cc3)cc2)C(=O)Nc2c(SC)cc(C)nc2SC)cc1 InChI=1S/C30H30FN3O3S2/c1-20-17-27(38-3)28(29(32-20)39-4)33-30(35)34(18-21-5-11-24(36-2)12-6-21)19-22-7-13-25(14-8-22)37-26-15-9-23(31)10-16-26/h5-17H,18-19H2,1-4H3,(H,33,35) ZCWSAHJZMGYQTP-UHFFFAOYSA-N 50067757 1-[4-(4-Fluoro-phenoxy)-benzyl]-1-(4-methoxy-benzyl)-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-urea::CHEMBL343323 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 29 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067757 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067757&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10840668 103962183 CHEMBL343323 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054740 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCOCC1 InChI=1S/C27H30FN3O3S2/c1-18-16-24(35-2)25(26(29-18)36-3)30-27(32)31(21-12-14-33-15-13-21)17-19-4-8-22(9-5-19)34-23-10-6-20(28)7-11-23/h4-11,16,21H,12-15,17H2,1-3H3,(H,30,32) AVTXSQIEEOCWLR-UHFFFAOYSA-N 50067766 1-[4-(4-Fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-1-(tetrahydro-pyran-4-yl)-urea::CHEMBL341955 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 46 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067766 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067766&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10744706 103962192 CHEMBL341955 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054743 Cc1cc(c(NC(=O)N(Cc2ccc(Oc3ccc(F)cc3)cc2)C2CCCCCC2)c(n1)S(C)(=O)=O)S(C)(=O)=O InChI=1S/C29H34FN3O6S2/c1-20-18-26(40(2,35)36)27(28(31-20)41(3,37)38)32-29(34)33(23-8-6-4-5-7-9-23)19-21-10-14-24(15-11-21)39-25-16-12-22(30)13-17-25/h10-18,23H,4-9,19H2,1-3H3,(H,32,34) UFRBZRWETFGORO-UHFFFAOYSA-N 50067759 3-(2,4-Bis-methanesulfonyl-6-methyl-pyridin-3-yl)-1-cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-urea::CHEMBL138323 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 45 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067759 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067759&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 6918442 103962185 CHEMBL138323 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054747 Cc1cc(Cl)c(NC(=O)N(Cc2ccc(Oc3ccc(F)cc3)cc2)C2CCCCCC2)c(Cl)n1 InChI=1S/C27H28Cl2FN3O2/c1-18-16-24(28)25(26(29)31-18)32-27(34)33(21-6-4-2-3-5-7-21)17-19-8-12-22(13-9-19)35-23-14-10-20(30)11-15-23/h8-16,21H,2-7,17H2,1H3,(H,32,34) RMNCJFQVJCRCQN-UHFFFAOYSA-N 50067753 1-Cycloheptyl-3-(2,4-dichloro-6-methyl-pyridin-3-yl)-1-[4-(4-fluoro-phenoxy)-benzyl]-urea::CHEMBL139173 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 14 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067753 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067753&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10744436 103962179 CHEMBL139173 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054748 Cc1cc(c(NC(=O)N(Cc2ccc(Oc3ccc(F)cc3)cc2)C2CCCCCC2)c(Cl)n1)S(C)(=O)=O InChI=1S/C28H31ClFN3O4S/c1-19-17-25(38(2,35)36)26(27(29)31-19)32-28(34)33(22-7-5-3-4-6-8-22)18-20-9-13-23(14-10-20)37-24-15-11-21(30)12-16-24/h9-17,22H,3-8,18H2,1-2H3,(H,32,34) FWJYMSWCKJMBRP-UHFFFAOYSA-N 50067760 3-(2-Chloro-4-methanesulfonyl-6-methyl-pyridin-3-yl)-1-cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-urea::CHEMBL136438 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 30 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067760 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067760&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10554879 103962186 CHEMBL136438 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054751 COc1nc(C)cc(SC)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCCCCC1 InChI=1S/C29H34FN3O3S/c1-20-18-26(37-3)27(28(31-20)35-2)32-29(34)33(23-8-6-4-5-7-9-23)19-21-10-14-24(15-11-21)36-25-16-12-22(30)13-17-25/h10-18,23H,4-9,19H2,1-3H3,(H,32,34) IVPAMRCBHKDZDR-UHFFFAOYSA-N 50067745 1-Cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(2-methoxy-6-methyl-4-methylsulfanyl-pyridin-3-yl)-urea::CHEMBL139172 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 29 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067745 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067745&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 11800196 103962171 CHEMBL139172 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054754 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)Cc1c(C)cccc1C InChI=1S/C31H32FN3O2S2/c1-20-7-6-8-21(2)27(20)19-35(31(36)34-29-28(38-4)17-22(3)33-30(29)39-5)18-23-9-13-25(14-10-23)37-26-15-11-24(32)12-16-26/h6-17H,18-19H2,1-5H3,(H,34,36) KCADDCQXCNUJJA-UHFFFAOYSA-N 50067750 1-(2,6-Dimethyl-benzyl)-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-urea::CHEMBL139798 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 26 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067750 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067750&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10769240 103962176 CHEMBL139798 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054757 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCCCC1 InChI=1S/C28H32FN3O2S2/c1-19-17-25(35-2)26(27(30-19)36-3)31-28(33)32(22-7-5-4-6-8-22)18-20-9-13-23(14-10-20)34-24-15-11-21(29)12-16-24/h9-17,22H,4-8,18H2,1-3H3,(H,31,33) PWMZLCPMBVLDED-UHFFFAOYSA-N 50067754 1-Cyclohexyl-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-urea::CHEMBL136368 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 23 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067754 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067754&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10839831 103962180 CHEMBL136368 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054761 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)[C@@H](C)c1ccccc1 InChI=1S/C30H30FN3O2S2/c1-20-18-27(37-3)28(29(32-20)38-4)33-30(35)34(21(2)23-8-6-5-7-9-23)19-22-10-14-25(15-11-22)36-26-16-12-24(31)13-17-26/h5-18,21H,19H2,1-4H3,(H,33,35) RXABMMVHUSZKIM-UHFFFAOYSA-N 50067767 1-[(S)-4-(4-Fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-1-(1-phenyl-ethyl)-urea::CHEMBL139273 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 19 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067767 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067767&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10792700 103962193 CHEMBL139273 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054762 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)[C@H](C)c1ccccc1 InChI=1S/C30H30FN3O2S2/c1-20-18-27(37-3)28(29(32-20)38-4)33-30(35)34(21(2)23-8-6-5-7-9-23)19-22-10-14-25(15-11-22)36-26-16-12-24(31)13-17-26/h5-18,21H,19H2,1-4H3,(H,33,35) RXABMMVHUSZKIM-UHFFFAOYSA-N 50067749 1-[(R)-4-(4-Fluoro-phenoxy)-benzyl]-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-1-(1-phenyl-ethyl)-urea::CHEMBL440722 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 19 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067749 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067749&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10816432 103962175 CHEMBL440722 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054763 CSc1cc(C)nc(SC)c1NC(=O)N(Cc1ccccc1)Cc1cccc(c1)-c1cc[nH]n1 InChI=1S/C26H27N5OS2/c1-18-14-23(33-2)24(25(28-18)34-3)29-26(32)31(16-19-8-5-4-6-9-19)17-20-10-7-11-21(15-20)22-12-13-27-30-22/h4-15H,16-17H2,1-3H3,(H,27,30)(H,29,32) XCMUCRXXBCAKCO-UHFFFAOYSA-N 50065044 FR-186054::1-Benzyl-3-(6-methyl-2,4-bis-methylsulfanyl-pyridin-3-yl)-1-[3-(2H-pyrazol-3-yl)-benzyl]-urea::CHEMBL311725 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 99 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065044 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065044&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 6918389 103959999 CHEMBL311725 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054766 Cc1cc(C)c(NC(=O)N(Cc2ccc(Oc3ccc(F)cc3)cc2)C2CCCCCC2)c(C)c1 InChI=1S/C30H35FN2O2/c1-21-18-22(2)29(23(3)19-21)32-30(34)33(26-8-6-4-5-7-9-26)20-24-10-14-27(15-11-24)35-28-16-12-25(31)13-17-28/h10-19,26H,4-9,20H2,1-3H3,(H,32,34) XGSPYZRAWSMUHY-UHFFFAOYSA-N 50067744 FR-179254::1-Cycloheptyl-1-[4-(4-fluoro-phenoxy)-benzyl]-3-(2,4,6-trimethyl-phenyl)-urea::CHEMBL139220 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 25 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067744 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067744&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10027879 103962170 CHEMBL139220 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50054769 COc1cc(C)nc(OC)c1NC(=O)N(Cc1ccc(Oc2ccc(F)cc2)cc1)C1CCCCCC1 InChI=1S/C29H34FN3O4/c1-20-18-26(35-2)27(28(31-20)36-3)32-29(34)33(23-8-6-4-5-7-9-23)19-21-10-14-24(15-11-21)37-25-16-12-22(30)13-17-25/h10-18,23H,4-9,19H2,1-3H3,(H,32,34) OYDQSCXQFJFQBE-UHFFFAOYSA-N 50067765 1-Cycloheptyl-3-(2,4-dimethoxy-6-methyl-pyridin-3-yl)-1-[4-(4-fluoro-phenoxy)-benzyl]-urea::CHEMBL138214 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 33 ChEMBL 10.1021/jm980399q 10.7270/Q2QC02MT 9784116 Tanaka, A; Terasawa, T; Hagihara, H; Ishibe, N; Sawada, M; Sakuma, Y; Hashimoto, M; Takasugi, H; Tanaka, H 11/23/1998 11/10/2009 Fujisawa Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067765 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067765&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10529610 103962191 CHEMBL138214 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214