BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50786990 [#8]-c1ccc(\[#6]=[#6]-2\[#6](=O)-c3ccccc3-[#6]-2=O)cc1-[#8] InChI=1S/C16H7O4/c17-13-6-5-9(8-14(13)18)7-12-15(19)10-3-1-2-4-11(10)16(12)20/h1-6,8H GQCXHTDRVKNGSA-UHFFFAOYSA-N 50067024 2-(3,4-Dihydroxy-benzylidene)-indan-1,3-dione::CHEMBL83598 Integrase Human immunodeficiency virus 1 3000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067024 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067024&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 468132 103961557 CHEMBL83598 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50786991 Oc1ccc(\C=C2/COC\C(=C/c3ccc(O)c(O)c3)C2=O)cc1O InChI=1S/C19H16O6/c20-15-3-1-11(7-17(15)22)5-13-9-25-10-14(19(13)24)6-12-2-4-16(21)18(23)8-12/h1-8,20-23H,9-10H2 WJXMHIODWHBGHP-UHFFFAOYSA-N 50067025 3,5-Bis-(3,4-dihydroxy-benzylidene)-tetrahydro-pyran-4-one::3,5-Bis-[1-(3,4-dihydroxy-phenyl)-meth-(E)-ylidene]-tetrahydro-pyran-4-one::CHEMBL419981 Integrase Human immunodeficiency virus 1 200 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067025 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067025&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474889 103961558 CHEMBL419981 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50786992 Oc1ccc(\C=C\C(=O)c2ccccc2)cc1O InChI=1S/C15H12O3/c16-13(12-4-2-1-3-5-12)8-6-11-7-9-14(17)15(18)10-11/h1-10,17-18H HHKVOYUYPYZFHJ-UHFFFAOYSA-N 50042963 3,4-dihydroxychalcone::(E)-3-(3,4-Dihydroxy-phenyl)-1-phenyl-propenone::3-(3,4-dihydroxyphenyl)-1-phenylprop-2-en-1-one::3-(3,4-Dihydroxy-phenyl)-1-phenyl-propenone::CHEMBL129510 Integrase Human immunodeficiency virus 1 2300 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50042963 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50042963&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474896 103974460 CHEMBL129510 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50786993 c1cc(ccc1C=CC(=O)c2ccc(cc2O)O)O InChI=1S/C15H12O4/c16-11-4-1-10(2-5-11)3-8-14(18)13-7-6-12(17)9-15(13)19/h1-9,16-17,19H DXDRHHKMWQZJHT-UHFFFAOYSA-N 50042944 cid_638278::(E)-1-(2,4-Dihydroxy-phenyl)-3-(4-hydroxy-phenyl)-propenone::1-(2,4-Dihydroxy-phenyl)-3-(4-hydroxy-phenyl)-propenone::2,4'-dihydroxy-4-hydroxychalcone::(E)-1-(2,4-dihydroxyphenyl)-3-(4-hydroxyphenyl)prop-2-en-1-one::2',4,4'-trihydroxychalcone::2',4',4-trihydroxychalcone::CHEMBL129795::1-(2,4-dihydroxyphenyl)-3-(4-hydroxyphenyl)prop-2-en-1-one::1-(2,4-Dihydroxyphenyl)-3-(4-hydroxyphenyl)-prop-2-en-1-one::Isoliquiritigenin (1) Integrase Human immunodeficiency virus 1 >100000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50042944 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50042944&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search HCC 1FP1,4RLU,5YX4,6AJV,6AJX,9INV 638278 103974441 CHEMBL129795 DB03285 C08650 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50786994 C[C@@H]1OC[C@@H]2[C@@H](O1)[C@@H]([C@H]([C@@H](O2)O[C@@H]3c4cc5c(cc4[C@H]([C@@H]6[C@@H]3COC6=O)c7cc(c(c(c7)OC)O)OC)OCO5)O)O InChI=1S/C29H32O13/c1-11-36-9-20-27(40-11)24(31)25(32)29(41-20)42-26-14-7-17-16(38-10-39-17)6-13(14)21(22-15(26)8-37-28(22)33)12-4-18(34-2)23(30)19(5-12)35-3/h4-7,11,15,20-22,24-27,29-32H,8-10H2,1-3H3 VJJPUSNTGOMMGY-UHFFFAOYSA-N 50127140 4'-Demethylepipodophyllotoxin 9-(4,6-O-(R)-ethylidene-beta-D-glucopyranoside)::4-demethylepipodophyllotoxin beta-D-ethylideneglucoside::9-((4,6-O-Ethylidine-beta-D-glucopyranosyl)oxy)-5,8,8a,9-tetrahydro-5-(4-hydroxy-3,4-dimethyloxyphenyl)furo(3',4'':6,7)naptho-(2,3-d)-1,3-dioxol-6(5aH)-one::VP-16::CHEMBL44657::(5S,5aR,8aR,9R)-9-(4-hydroxy-3,5-dimethoxyphenyl)-8-oxo-5,5a,6,8,8a,9-hexahydrofuro[3',4':6,7]naphtho[2,3-d][1,3]dioxol-5-yl 4,6-O-[(1R)-ethylidene]-beta-D-glucopyranoside::etoposide::(-)-etoposide::TRANS-ETOPOSIDE::Etoposide (ET) Integrase Human immunodeficiency virus 1 >100000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50127140 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50127140&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search EVP 3QX3,4LB9,5CDN,5CDP,5GWK,5ZRF,6ZY5,6ZY6,6ZY7,6ZY8,7YQ8,8J9V,8J9W 36462 104019076 CHEMBL44657 DB00773 C01576 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50786995 Oc1ccc(\C=C2/CCC\C(=C/c3ccc(O)c(O)c3)C2=O)cc1O InChI=1S/C20H18O5/c21-16-6-4-12(10-18(16)23)8-14-2-1-3-15(20(14)25)9-13-5-7-17(22)19(24)11-13/h4-11,21-24H,1-3H2 JZODVJPLOFJTJZ-UHFFFAOYSA-N 50067027 2,6-bis(3,4-dihydroxybenzylidene)cyclohexanone::2,6-Bis-(3,4-dihydroxy-benzylidene)-cyclohexanone::2,6-Bis-[1-(3,4-dihydroxy-phenyl)-meth-(E)-ylidene]-cyclohexanone::CHEMBL129148 Integrase Human immunodeficiency virus 1 900 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067027 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067027&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5467476 103961560 CHEMBL129148 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50786996 O=C(CC(=O)C=Cc1ccccc1)C=Cc1ccccc1 |w:5.4,14.15| InChI=1S/C19H16O2/c20-18(13-11-16-7-3-1-4-8-16)15-19(21)14-12-17-9-5-2-6-10-17/h1-14H,15H2 UXLWOYFDJVFCBR-UHFFFAOYSA-N 50067031 5-Hydroxy-1,7-diphenylhepta-1,4,6-trien-3-one::(1E,4Z,6E)-5-Hydroxy-1,7-diphenyl-hepta-1,4,6-trien-3-one::5-Hydroxy-1,7-diphenyl-hepta-1,4,6-trien-3-one::CHEMBL129913 Integrase Human immunodeficiency virus 1 >100000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067031 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067031&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5469422 103961564 CHEMBL129913 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50786997 CC[C@@]1(O)C(=O)OCc2c1cc1-c3nc4ccccc4cc3Cn1c2=O |r| InChI=1S/C20H16N2O4/c1-2-20(25)14-8-16-17-12(7-11-5-3-4-6-15(11)21-17)9-22(16)18(23)13(14)10-26-19(20)24/h3-8,25H,2,9-10H2,1H3 VSJKWCGYPAHWDS-UHFFFAOYSA-N 50008923 4-Ethyl-4-hydroxy-1,12-dihydro-4H-2-oxa-6,12a-diaza-dibenzo[b,h]fluorene-3,13-dione (Camptothecin)::cid_24360::4-Ethyl-4-hydroxy-1,12-dihydro-4H-2-oxa-6,12a-diaza-dibenzo[b,h]fluorene-3,13-dione::4-ethyl-4-hydroxy-(4S)-3,4,12,14-tetrahydro-1H-pyrano[3',4':6,7]indolizino[1,2-b]quinoline-3,14-dione::camptothecine::4-Ethyl-4-hydroxy-1,12-dihydro-4H-2-oxa-6,12a-diaza-dibenzo[b,h]fluorene-3,13-dione (CPT, Camptothecin)::CHEMBL65::(S)-4-ethyl-4-hydroxy-1,12-dihydro-4H-2-oxa-6,12a-diaza-dibenzo[b,h]fluorene-3,13-dione::4-Ethyl-4-hydroxy-1,12-dihydro-4H-2-oxa-6,12a-diaza-dibenzo[b,h]fluorene-3,13-dione (camptothecin or CPT)::(S)-4-ethyl-4-hydroxy-1,12-dihydro-4H-2-oxa-6,12a-diaza-dibenzo[b,h]florene-3,13-dione::Camptothecin (CT)::US20240246941, Compound SJ000285410 Integrase Human immunodeficiency virus 1 >100000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50008923 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50008923&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 24360 103922003 CHEMBL65 DB04690 C01897 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50786998 COc1cc(\C=C\C(=O)\C=C\c2ccc(O)c(OC)c2)ccc1O InChI=1S/C19H18O5/c1-23-18-11-13(5-9-16(18)21)3-7-15(20)8-4-14-6-10-17(22)19(12-14)24-2/h3-12,21-22H,1-2H3 ISIMGBQRFXXNON-UHFFFAOYSA-N 50067028 (1E,4E)-1,5-Bis-(4-hydroxy-3-methoxy-phenyl)-penta-1,4-dien-3-one::1,5-Bis(4-hydroxy-3-methoxyphenyl)penta-1,4-dien-3-one::(1E,4E)-1,5-bis(4-hydroxy-3-methoxyphenyl)penta-1,4-dien-3-one::1,5-bis-(4-hydroxy-3-methoxyphenyl)-penta-1,4-dien-3-one::1,5-Bis-(4-hydroxy-3-methoxy-phenyl)-penta-1,4-dien-3-one::Go-Y022::CHEMBL128729 Integrase Human immunodeficiency virus 1 37000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067028 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067028&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474893 103961561 CHEMBL128729 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50786999 Oc1ccc(\C=C2/Cc3ccccc3C2=O)cc1O InChI=1S/C16H12O3/c17-14-6-5-10(8-15(14)18)7-12-9-11-3-1-2-4-13(11)16(12)19/h1-8,17-18H,9H2 PPOMQCAGVJQMEO-UHFFFAOYSA-N 50067029 2-(3,4-Dihydroxy-benzylidene)-indan-1-one::2-[1-(3,4-Dihydroxy-phenyl)-meth-(E)-ylidene]-indan-1-one::CHEMBL126625 Integrase Human immunodeficiency virus 1 86000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067029 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067029&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474892 103961562 CHEMBL126625 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787000 Oc1ccc(C=CC(=O)CC(=O)C=Cc2ccc(O)c(O)c2)cc1O |w:5.4,13.13| InChI=1S/C19H16O6/c20-14(5-1-12-3-7-16(22)18(24)9-12)11-15(21)6-2-13-4-8-17(23)19(25)10-13/h1-10,22-25H,11H2 OJFGQVZAISEIPG-UHFFFAOYSA-N 50067030 1,7-bis(3,4-dihydroxyphenyl)-5-hydroxyhepta-1,4,6-trien-3-one::1,7-Bis-(3,4-dihydroxy-phenyl)-5-hydroxy-hepta-1,4,6-trien-3-one::(1E,4Z,6E)-1,7-bis(3,4-dihydroxyphenyl)-5-hydroxyhepta-1,4,6-trien-3-one::(1E,4Z,6E)-1,7-Bis-(3,4-dihydroxy-phenyl)-5-hydroxy-hepta-1,4,6-trien-3-one::CHEMBL129964 Integrase Human immunodeficiency virus 1 700 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067030 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067030&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5469425 103961563 CHEMBL129964 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787001 Oc1ccc(\C=C\C(=O)c2cccc(c2)C(=O)\C=C\c2ccc(O)cc2)cc1 InChI=1S/C24H18O4/c25-21-10-4-17(5-11-21)8-14-23(27)19-2-1-3-20(16-19)24(28)15-9-18-6-12-22(26)13-7-18/h1-16,25-26H OETARLPOXIOAFP-UHFFFAOYSA-N 50067032 3-(4-Hydroxy-phenyl)-1-{3-[3-(4-hydroxy-phenyl)-acryloyl]-phenyl}-propenone::(E)-3-(4-Hydroxy-phenyl)-1-{3-[(E)-3-(4-hydroxy-phenyl)-acryloyl]-phenyl}-propenone::CHEMBL340202 Integrase Human immunodeficiency virus 1 30000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067032 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067032&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474900 103961565 CHEMBL340202 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787002 COc1cc(\C=C2/CCC\C(=C/c3ccc(O)c(OC)c3)C2=O)ccc1O InChI=1S/C22H22O5/c1-26-20-12-14(6-8-18(20)23)10-16-4-3-5-17(22(16)25)11-15-7-9-19(24)21(13-15)27-2/h6-13,23-24H,3-5H2,1-2H3 DHKKONBXGAAFTB-UHFFFAOYSA-N 50067033 2,6-Bis-[1-(4-hydroxy-3-methoxy-phenyl)-meth-(E)-ylidene]-cyclohexanone::Cyclovalone::2,6-Bis((3-methoxy-4-hydroxyphenyl)methylene)-cyclohexanone::cid_1550234::(2E,6E)-2,6-bis(4-hydroxy-3-methoxybenzylidene)cyclohexanone::2,6-Bis-(4-hydroxy-3-methoxy-benzylidene)-cyclohexanone::CHEMBL17205::2,6-bis(4-hydroxy-3-methoxybenzylidene)cyclohexanone::US9187397, 38a Integrase Human immunodeficiency virus 1 >100000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067033&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 1550234 103961566 CHEMBL17205 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787003 Oc1ccc(\C=C\C(=O)c2cccc(c2)C(=O)\C=C\c2ccc(O)c(O)c2)cc1O InChI=1S/C24H18O6/c25-19(8-4-15-6-10-21(27)23(29)12-15)17-2-1-3-18(14-17)20(26)9-5-16-7-11-22(28)24(30)13-16/h1-14,27-30H KEADYQMWJKSLPM-UHFFFAOYSA-N 50067035 (E)-3-(3,4-Dihydroxy-phenyl)-1-{3-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyl]-phenyl}-propenone::3-(3,4-Dihydroxy-phenyl)-1-{3-[3-(3,4-dihydroxy-phenyl)-acryloyl]-phenyl}-propenone::CHEMBL339815 Integrase Human immunodeficiency virus 1 800 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067035 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067035&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474899 103961568 CHEMBL339815 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787004 COc1ccc(\C=C\C(=O)\C=C\c2ccc(OC)c(OC)c2)cc1OC InChI=1S/C21H22O5/c1-23-18-11-7-15(13-20(18)25-3)5-9-17(22)10-6-16-8-12-19(24-2)21(14-16)26-4/h5-14H,1-4H3 BUWQOPHMYRXMLL-UHFFFAOYSA-N 50067034 1,5-Bis-(3,4-dimethoxy-phenyl)-penta-1,4-dien-3-one::(1,5-bis(3,4-dimethoxyphenyl)-(1E,4E)-1,4-pentadien-3-one)::1,5-bis-(3,4-dimethoxyphenyl)-penta-1,4-dien-3-one::1,5-bis(3,4-dimethoxyphenyl)penta-1,4-dien-3-one::(1E,4E)-1,5-Bis-(3,4-dimethoxy-phenyl)-penta-1,4-dien-3-one::Go-Y035::CHEMBL423698 Integrase Human immunodeficiency virus 1 >100000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067034 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067034&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 1381237 103961567 CHEMBL423698 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787005 Oc1ccc(\C=C2/CC\C(=C/c3ccc(O)c(O)c3)C2=O)cc1O InChI=1S/C19H16O5/c20-15-5-1-11(9-17(15)22)7-13-3-4-14(19(13)24)8-12-2-6-16(21)18(23)10-12/h1-2,5-10,20-23H,3-4H2 MJDXEGMXLDBXSV-UHFFFAOYSA-N 50067037 2,5-Bis-(3,4-dihydroxy-benzylidene)-cyclopentanone::2,5-Bis-[1-(3,4-dihydroxy-phenyl)-meth-(E)-ylidene]-cyclopentanone::CHEMBL276080 Integrase Human immunodeficiency virus 1 1000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067037 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067037&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5468263 103961569 CHEMBL276080 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787006 Nc1nnc[nH]1 InChI=1S/C2H4N4/c3-2-4-1-5-6-2/h1H,(H3,3,4,5,6) KLSJWNVTNUYHDU-UHFFFAOYSA-N 50204936 4H-1,2,4-triazol-3-amine::1H-[1,2,4]Triazol-3-ylamine::Amitrole::3-AMINO-1,2,4-TRIAZOLE::2H-[1,2,4]Triazol-3-ylamine::CHEMBL232801 Integrase Human immunodeficiency virus 1 170 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50204936 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50204936&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 1639 104083404 CHEMBL232801 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787007 COc1ccc(C=CC(=O)CC(=O)C=Cc2ccc(OC)c(OC)c2)cc1OC |w:6.5,13.12| InChI=1S/C23H24O6/c1-26-20-11-7-16(13-22(20)28-3)5-9-18(24)15-19(25)10-6-17-8-12-21(27-2)23(14-17)29-4/h5-14H,15H2,1-4H3 HMJSBVCDPKODEX-UHFFFAOYSA-N 50067038 (1E,4Z,6E)-1,7-bis(3,4-dimethoxyphenyl)-5-hydroxyhepta-1,4,6-trien-3-one::1,7-Bis-(3,4-dimethoxy-phenyl)-5-hydroxy-hepta-1,4,6-trien-3-one::(1E,4Z,6E)-1,7-Bis-(3,4-dimethoxy-phenyl)-5-hydroxy-hepta-1,4,6-trien-3-one::Go-Y025::1,7-bis(3,4-dimethoxyphenyl)-5-hydroxyhepta-1,4,6-trien-3-one::CHEMBL128748 Integrase Human immunodeficiency virus 1 >100000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067038 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067038&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 9952605 103961570 CHEMBL128748 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787008 Oc1ccc(\C=C\C(=O)\C=C\c2ccc(O)c(O)c2)cc1O InChI=1S/C17H14O5/c18-13(5-1-11-3-7-14(19)16(21)9-11)6-2-12-4-8-15(20)17(22)10-12/h1-10,19-22H MOPYIPOZUDHBJM-UHFFFAOYSA-N 50067039 1,5-Bis-(3,4-dihydroxy-phenyl)-penta-1,4-dien-3-one::(1E,4E)-1,5-Bis-(3,4-dihydroxy-phenyl)-penta-1,4-dien-3-one::CHEMBL129073 Integrase Human immunodeficiency virus 1 600 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067039 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067039&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474894 103961571 CHEMBL129073 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787009 COc1cc(C=CC(=O)CC(=O)C=Cc2ccc(O)c(OC)c2)ccc1O |w:12.11,5.4| InChI=1S/C21H20O6/c1-26-20-11-14(5-9-18(20)24)3-7-16(22)13-17(23)8-4-15-6-10-19(25)21(12-15)27-2/h3-12,24-25H,13H2,1-2H3 VFLDPWHFBUODDF-UHFFFAOYSA-N 50067040 CHEMBL116438::1,7-bis(4-hydroxy-3-methoxyphenyl)1,6-heptadiene-3,5-dione::cid_5281767::curcumin I::(1E,4Z,6E)-5-hydroxy-1,7-bis(4-hydroxy-3-methoxyphenyl)hepta-1,4,6-trien-3-one::diferuloylmethane::(1E,4Z,6E)-5-Hydroxy-1,7-bis-(4-hydroxy-3-methoxy-phenyl)-hepta-1,4,6-trien-3-one::(1Z,6E)-1,7-Bis-(4-hydroxy-3-methoxy-phenyl)-hepta-1,6-diene-3,5-dione::(1E,6E)-1,7-bis(4-hydroxy-3-methoxyphenyl)hepta-1,6-diene-3,5-dione::1,7-bis-(4-hydroxy-3-methoxyphenyl)-1,6-heptadiene-3,5-dione::1,7-bis(4-hydroxy-3-methoxyphenyl)-1,6-heptadien-3,5-dione::5-hydroxy-1,7-bis(4-hydroxy-3-methoxyphenyl)-1,4,6-heptatrien-3-one::1,7-bis(4-hydroxy-3-methoxyphenyl)hepta-1,6-diene-3,5-dione::5-Hydroxy-1,7-bis-(4-hydroxy-3-methoxy-phenyl)-hepta-1,4,6-trien-3-one::(1E,6E)-1,7-Bis-(4-hydroxy-3-methoxy-phenyl)-hepta-1,6-diene-3,5-dione::1,7-bis(4-hydroxy-3-methoxyphenyl)-1,6-heptadiene-3,5-dione::1,7-Bis-(4-hydroxy-3-methoxy-phenyl)-hepta-1,6-diene-3,5-dione::(1E,6E)-1,7-bis(4-hydroxy-3-methoxyphenyl)-1,6-heptadiene-3,5-dione::curcurmin::((E,E)-1,7-bis(4-hydroxy-3-methoxyphenyl)-1,6-heptadiene-3,5-dione)::(E,E)-1,7-Bis(4-hydroxy-3-methoxyphenyl)-1,6-heptadiene-3,5-dione::curcumine Integrase Human immunodeficiency virus 1 30000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067040 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067040&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 969516 103961572 CHEMBL116438 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787010 Oc1ccc(\C=C2/C[NH2+]C\C(=C/c3ccc(O)c(O)c3)C2=O)cc1O InChI=1S/C19H17NO5/c21-15-3-1-11(7-17(15)23)5-13-9-20-10-14(19(13)25)6-12-2-4-16(22)18(24)8-12/h1-8,20-24H,9-10H2/p+1 XXLSPXONMWOWKM-UHFFFAOYSA-O 50067041 3,5-Bis-[1-(3,4-dihydroxy-phenyl)-meth-(E)-ylidene]-4-oxo-piperidinium; chloride::CHEMBL340775 Integrase Human immunodeficiency virus 1 200 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067041 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067041&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 44381221 103961573 CHEMBL340775 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787011 Oc1ccc(C=CC(=O)CC(=O)C=Cc2ccc(O)cc2)cc1 |w:12.11,5.4| InChI=1S/C19H16O4/c20-16-7-1-14(2-8-16)5-11-18(22)13-19(23)12-6-15-3-9-17(21)10-4-15/h1-12,20-21H,13H2 PREBVFJICNPEKM-UHFFFAOYSA-N 50059989 cid_5324473::CHEMBL105350::1,7-bis(4-hydroxyphenyl)-3-hydroxy-1,3,6-heptatrien-5-one::(1E,6E)-1,7-Bis-(4-hydroxy-phenyl)-hepta-1,6-diene-3,5-dione::bis-demethoxycurcumin::(1E,4Z,6E)-5-Hydroxy-1,7-bis-(4-hydroxy-phenyl)-hepta-1,4,6-trien-3-one::curcumin III::5-Hydroxy-1,7-bis(4-hydroxyphenyl)hepta-1,4,6-trien-3-one::CHEMBL131770::1,7-bis(4-hydroxyphenyl)-1,6-heptadiene-3,5-dione::5-Hydroxy-1,7-bis-(4-hydroxy-phenyl)-hepta-1,4,6-trien-3-one Integrase Human immunodeficiency virus 1 >100000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50059989 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50059989&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 5315472 103955764 CHEMBL131770CHEMBL105350 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787012 Oc1ccc(\C=C2/CSC\C(=C/c3ccc(O)c(O)c3)C2=O)cc1O InChI=1S/C19H16O5S/c20-15-3-1-11(7-17(15)22)5-13-9-25-10-14(19(13)24)6-12-2-4-16(21)18(23)8-12/h1-8,20-23H,9-10H2 OCEQKZUESGBZAG-UHFFFAOYSA-N 50067043 3,5-Bis-(3,4-dihydroxy-benzylidene)-tetrahydro-thiopyran-4-one::3,5-Bis-[1-(3,4-dihydroxy-phenyl)-meth-(Z)-ylidene]-tetrahydro-thiopyran-4-one::CHEMBL130911 Integrase Human immunodeficiency virus 1 200 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067043 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067043&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474890 103961575 CHEMBL130911 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787013 c1cc(c(cc1/C=C/C(=O)c2ccc(cc2O)O)O)O InChI=1S/C15H12O5/c16-10-3-4-11(14(19)8-10)12(17)5-1-9-2-6-13(18)15(20)7-9/h1-8,16,18-20H AYMYWHCQALZEGT-UHFFFAOYSA-N 50042949 (E)-3-(3,4-Dihydroxy-phenyl)-1-(2,4-dihydroxy-phenyl)-propenone::Butein::(E)-1-(2,4-dihydroxyphenyl)-3-(3,4-dihydroxyphenyl)prop-2-en-1-one::3,4,2',4'-tetrahydroxychalone::3-(3,4-Dihydroxy-phenyl)-1-(2,4-dihydroxy-phenyl)-propenone::CHEMBL128000::(E)-1-(2,4-dihydroxyphenyl)-3-(3,4-dihydroxyphenyl)-2-propen-1-one (21) Integrase Human immunodeficiency virus 1 20000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50042949 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50042949&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search BUN 4RLW 5281222 103974446 CHEMBL128000 C08578 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787014 Oc1ccc(C=CC(=O)CCc2ccccc2)cc1O |w:6.6| InChI=1S/C17H16O3/c18-15(9-6-13-4-2-1-3-5-13)10-7-14-8-11-16(19)17(20)12-14/h1-5,7-8,10-12,19-20H,6,9H2 LOEMUCWNSZVSGY-UHFFFAOYSA-N 50067045 1-(3,4-Dihydroxy-phenyl)-5-phenyl-pent-1-en-3-one::(E)-1-(3,4-Dihydroxy-phenyl)-5-phenyl-pent-1-en-3-one::CHEMBL127028 Integrase Human immunodeficiency virus 1 >100000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067045 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067045&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474901 103961577 CHEMBL127028 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787015 Oc1ccc(\C=C\C(=O)\C=C\c2ccc(O)cc2)cc1 InChI=1S/C17H14O3/c18-15-7-1-13(2-8-15)5-11-17(20)12-6-14-3-9-16(19)10-4-14/h1-12,18-19H FTEGUKWEUQPKIS-UHFFFAOYSA-N 50067044 (1E,4E)-1,5-bis(4-hydroxyphenyl)penta-1,4-dien-3-one::(1E,4E)-1,5-Bis-(4-hydroxy-phenyl)-penta-1,4-dien-3-one::1,5-Bis-(4-hydroxy-phenyl)-penta-1,4-dien-3-one::1,5-Bis(4-hydroxyphenyl)penta-1,4-dien-3-one::CHEMBL129134 Integrase Human immunodeficiency virus 1 >100000 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50067044 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50067044&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6437306 103961576 CHEMBL129134 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1 50787016 Oc1ccc(cc1)C(=O)\C=C\c1ccc(O)c(O)c1 InChI=1S/C15H12O4/c16-12-5-3-11(4-6-12)13(17)7-1-10-2-8-14(18)15(19)9-10/h1-9,16,18-19H UPERCWWUZZKHCL-UHFFFAOYSA-N 50042962 3-(3,4-Dihydroxy-phenyl)-1-(4-hydroxy-phenyl)-propenone::(E)-3-(3,4-Dihydroxy-phenyl)-1-(4-hydroxy-phenyl)-propenone::CHEMBL341135 Integrase Human immunodeficiency virus 1 1300 ChEMBL 10.1021/jm9707232 10.7270/Q29024G3 9767632 Artico, M; Di Santo, R; Costi, R; Novellino, E; Greco, G; Massa, S; Tramontano, E; Marongiu, ME; De Montis, A; La Colla, P 11/3/1998 11/8/2012 Sapienza University of Rome http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50042962 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004989&target=Integrase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50042962&enzyme=Integrase&column=ki&startPg=0&Increment=50&submit=Search 6474895 103974459 CHEMBL341135 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED 8FNH,8FND,8FNG,5U1C,6EB2,6EB1,8ZHA,8ZH4,7KE0,6NUJ,20XX,7WCE,7D83,6LMQ,6LMI,3LPU,3LPT,2B4J,1ITG,1HYZ,1HYV,8BV2,5OI5,5OI2,4LH5,4LH4,8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P,5HRN,4OJR Gag-Pol polyprotein Q7ZJM1_HV1 Q7ZJM1