BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50112708 Clc1ccc(OCc2nc3c(OCCC[C@H]4CCCNC4)cccc3n2CCC[C@@H]2CCCNC2)cc1 InChI=1S/C30H41ClN4O2/c31-25-12-14-26(15-13-25)37-22-29-34-30-27(35(29)18-4-8-23-6-2-16-32-20-23)10-1-11-28(30)36-19-5-9-24-7-3-17-33-21-24/h1,10-15,23-24,32-33H,2-9,16-22H2 KWGDURXIKWPRNZ-UHFFFAOYSA-N 50065459 2-(4-Chloro-phenoxymethyl)-4-((R)-3-piperidin-3-yl-propoxy)-1-((S)-3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL328532 Neuropeptide Y receptor type 1 Homo sapiens 27 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065459 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065459&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10676562 103960361 CHEMBL328532 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112709 Clc1ccc(OCc2nc3c(OCCC4CCNCC4)cccc3n2CCCC2CCCNC2)cc1 InChI=1S/C29H39ClN4O2/c30-24-8-10-25(11-9-24)36-21-28-33-29-26(34(28)18-3-5-23-4-2-15-32-20-23)6-1-7-27(29)35-19-14-22-12-16-31-17-13-22/h1,6-11,22-23,31-32H,2-5,12-21H2 JLWLQSJTQMABLN-UHFFFAOYSA-N 50065460 2-(4-Chloro-phenoxymethyl)-4-(2-piperidin-4-yl-ethoxy)-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL91462 Neuropeptide Y receptor type 1 Homo sapiens 7.0 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065460 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065460&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10747569 103960362 CHEMBL91462 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112710 Clc1ccc(OCc2nc3c(OCCC[C@@H]4CCCNC4)cccc3n2CCC[C@@H]2CCCNC2)cc1 InChI=1S/C30H41ClN4O2/c31-25-12-14-26(15-13-25)37-22-29-34-30-27(35(29)18-4-8-23-6-2-16-32-20-23)10-1-11-28(30)36-19-5-9-24-7-3-17-33-21-24/h1,10-15,23-24,32-33H,2-9,16-22H2 KWGDURXIKWPRNZ-UHFFFAOYSA-N 50065463 2-(4-Chloro-phenoxymethyl)-4-((S)-3-piperidin-3-yl-propoxy)-1-((S)-3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL330223 Neuropeptide Y receptor type 1 Homo sapiens 6 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065463 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065463&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10747659 103960365 CHEMBL330223 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112711 Cc1ccc2n(CCCC3CCCNC3)c(COc3ccc(Cl)cc3)nc2c1 InChI=1S/C23H28ClN3O/c1-17-6-11-22-21(14-17)26-23(16-28-20-9-7-19(24)8-10-20)27(22)13-3-5-18-4-2-12-25-15-18/h6-11,14,18,25H,2-5,12-13,15-16H2,1H3 JXZMAOZJVZKKEK-UHFFFAOYSA-N 50065464 2-(4-Chloro-phenoxymethyl)-5-methyl-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole; compound with 2-(4-chloro-phenoxymethyl)-6-methyl-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL210900 Neuropeptide Y receptor type 1 Homo sapiens 1290 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065464 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065464&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10577677 103960366 CHEMBL210900 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112712 Cc1cccc2n(CCCC3CCCNC3)c(COc3ccc(Cl)cc3)nc12 InChI=1S/C23H28ClN3O/c1-17-5-2-8-21-23(17)26-22(16-28-20-11-9-19(24)10-12-20)27(21)14-4-7-18-6-3-13-25-15-18/h2,5,8-12,18,25H,3-4,6-7,13-16H2,1H3 WAIGOCMMTMZHTI-UHFFFAOYSA-N 50065465 2-(4-Chloro-phenoxymethyl)-4-methyl-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL329224 Neuropeptide Y receptor type 1 Homo sapiens 97 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065465 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065465&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10625562 103960367 CHEMBL329224 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112713 Clc1ccc(OCc2nc3c(OCCC4CCCNC4)cccc3n2CCCC2CCCNC2)cc1 InChI=1S/C29H39ClN4O2/c30-24-10-12-25(13-11-24)36-21-28-33-29-26(34(28)17-4-7-22-5-2-15-31-19-22)8-1-9-27(29)35-18-14-23-6-3-16-32-20-23/h1,8-13,22-23,31-32H,2-7,14-21H2 ZJNOPNNJFLEQBQ-UHFFFAOYSA-N 50065466 2-(4-Chloro-phenoxymethyl)-4-(2-piperidin-3-yl-ethoxy)-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL93375 Neuropeptide Y receptor type 1 Homo sapiens 18 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065466 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065466&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10795082 103960368 CHEMBL93375 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112714 Clc1ccc(OCc2nc3c(OCCCN4CCCCC4)cccc3n2CCCC2CCCNC2)cc1 InChI=1S/C30H41ClN4O2/c31-25-12-14-26(15-13-25)37-23-29-33-30-27(35(29)20-6-9-24-8-5-16-32-22-24)10-4-11-28(30)36-21-7-19-34-17-2-1-3-18-34/h4,10-15,24,32H,1-3,5-9,16-23H2 SHFZELZOQAXTFF-UHFFFAOYSA-N 50065468 2-(4-Chloro-phenoxymethyl)-4-(3-piperidin-1-yl-propoxy)-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL61532 Neuropeptide Y receptor type 1 Homo sapiens 1.7 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065468 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065468&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10414488 103960370 CHEMBL61532 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112715 NC(=N)NCCCC(NC(=O)C(c1ccccc1)c1ccccc1)C(=O)NCc1ccc(O)cc1 InChI=1S/C27H31N5O3/c28-27(29)30-17-7-12-23(25(34)31-18-19-13-15-22(33)16-14-19)32-26(35)24(20-8-3-1-4-9-20)21-10-5-2-6-11-21/h1-6,8-11,13-16,23-24,33H,7,12,17-18H2,(H,31,34)(H,32,35)(H4,28,29,30) KUWBXRGRMQZCSS-UHFFFAOYSA-N 50065469 2-Diphenylacetylamino-5-guanidino-pentanoic acid 4-hydroxy-benzylamide::CHEMBL44246 Neuropeptide Y receptor type 1 Homo sapiens 4.6 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065469 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065469&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 21129772 103960371 CHEMBL44246 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112716 Clc1ccc(OCc2nc3c(OCCCC4CCCNC4)cccc3n2CCCC2CCCNC2)cc1 InChI=1S/C30H41ClN4O2/c31-25-12-14-26(15-13-25)37-22-29-34-30-27(35(29)18-4-8-23-6-2-16-32-20-23)10-1-11-28(30)36-19-5-9-24-7-3-17-33-21-24/h1,10-15,23-24,32-33H,2-9,16-22H2 KWGDURXIKWPRNZ-UHFFFAOYSA-N 50065461 2-(4-Chloro-phenoxymethyl)-4-(3-piperidin-3-yl-propoxy)-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL328541 Neuropeptide Y receptor type 1 Homo sapiens 30 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065461 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065461&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10605127 103960363 CHEMBL328541 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112717 Clc1ccc(OCc2nc3ccccc3n2CCC2CCNCC2)cc1 InChI=1S/C21H24ClN3O/c22-17-5-7-18(8-6-17)26-15-21-24-19-3-1-2-4-20(19)25(21)14-11-16-9-12-23-13-10-16/h1-8,16,23H,9-15H2 MRRRBCQPWCOTKO-UHFFFAOYSA-N 50065471 2-(4-Chloro-phenoxymethyl)-1-(2-piperidin-4-yl-ethyl)-1H-benzoimidazole::CHEMBL90574 Neuropeptide Y receptor type 1 Homo sapiens 940.0 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065471 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065471&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10791009 103960373 CHEMBL90574 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112718 Oc1cccc2n(CCCC3CCCNC3)c(COc3ccc(Cl)cc3)nc12 InChI=1S/C22H26ClN3O2/c23-17-8-10-18(11-9-17)28-15-21-25-22-19(6-1-7-20(22)27)26(21)13-3-5-16-4-2-12-24-14-16/h1,6-11,16,24,27H,2-5,12-15H2 WZNIGKOEGIWAPO-UHFFFAOYSA-N 50065470 2-(4-Chloro-phenoxymethyl)-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazol-4-ol::CHEMBL420613 Neuropeptide Y receptor type 1 Homo sapiens 5300 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065470 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065470&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10839529 103960372 CHEMBL420613 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112719 Clc1ccc(OCc2nc3c(OCCN4CCCCC4)cccc3n2CCCC2CCCNC2)cc1 InChI=1S/C29H39ClN4O2/c30-24-11-13-25(14-12-24)36-22-28-32-29-26(34(28)18-6-8-23-7-5-15-31-21-23)9-4-10-27(29)35-20-19-33-16-2-1-3-17-33/h4,9-14,23,31H,1-3,5-8,15-22H2 XYZHLFVUPCKXRB-UHFFFAOYSA-N 50065475 2-(4-Chloro-phenoxymethyl)-4-(2-piperidin-1-yl-ethoxy)-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL94292 Neuropeptide Y receptor type 1 Homo sapiens 43 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065475 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065475&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10722606 103960377 CHEMBL94292 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112720 Clc1ccc(OCc2nc3ccccc3n2CCCC2CCNCC2)cc1 InChI=1S/C22H26ClN3O/c23-18-7-9-19(10-8-18)27-16-22-25-20-5-1-2-6-21(20)26(22)15-3-4-17-11-13-24-14-12-17/h1-2,5-10,17,24H,3-4,11-16H2 STOCCRAFAIUTRW-UHFFFAOYSA-N 50065472 2-(4-Chloro-phenoxymethyl)-1-(3-piperidin-4-yl-propyl)-1H-benzoimidazole::CHEMBL90605 Neuropeptide Y receptor type 1 Homo sapiens 980.0 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065472 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065472&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10601378 103960374 CHEMBL90605 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112721 Cc1cccc2nc(COc3ccc(Cl)cc3)n(CCCC3CCCNC3)c12 InChI=1S/C23H28ClN3O/c1-17-5-2-8-21-23(17)27(14-4-7-18-6-3-13-25-15-18)22(26-21)16-28-20-11-9-19(24)10-12-20/h2,5,8-12,18,25H,3-4,6-7,13-16H2,1H3 JYHSAWORPZWUIB-UHFFFAOYSA-N 50065474 2-(4-Chloro-phenoxymethyl)-7-methyl-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL329786 Neuropeptide Y receptor type 1 Homo sapiens 400 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065474 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065474&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10673317 103960376 CHEMBL329786 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112722 Clc1ccc(OCc2nc3ccccc3n2CCC2CCCNC2)cc1 InChI=1S/C21H24ClN3O/c22-17-7-9-18(10-8-17)26-15-21-24-19-5-1-2-6-20(19)25(21)13-11-16-4-3-12-23-14-16/h1-2,5-10,16,23H,3-4,11-15H2 TUQGRYVTVRNIIC-UHFFFAOYSA-N 50065473 2-(4-Chloro-phenoxymethyl)-1-(2-piperidin-3-yl-ethyl)-1H-benzoimidazole::CHEMBL92685 Neuropeptide Y receptor type 1 Homo sapiens 1280 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065473 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065473&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 11799055 103960375 CHEMBL92685 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112723 Clc1ccc(OCc2c(C(=O)CN3CCC(CC3)N3CCCCC3)c3ccccc3n2CCC[C@@H]2CCCNC2)cc1 InChI=1S/C35H47ClN4O2/c36-28-12-14-30(15-13-28)42-26-33-35(34(41)25-38-22-16-29(17-23-38)39-19-4-1-5-20-39)31-10-2-3-11-32(31)40(33)21-7-9-27-8-6-18-37-24-27/h2-3,10-15,27,29,37H,1,4-9,16-26H2 XHHLNSWTGQCLAS-UHFFFAOYSA-N 50060725 2-[1,4']Bipiperidinyl-1'-yl-1-[2-(4-chloro-phenoxymethyl)-1-((S)-3-piperidin-3-yl-propyl)-1H-indol-3-yl]-ethanone::CHEMBL329536 Neuropeptide Y receptor type 1 Homo sapiens 0.75 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50060725 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50060725&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9916525 103956361 CHEMBL329536 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112724 Clc1ccc(OCc2nc3c(OCCC[C@@H]4CCCNC4)cccc3n2CCC[C@H]2CCCNC2)cc1 InChI=1S/C30H41ClN4O2/c31-25-12-14-26(15-13-25)37-22-29-34-30-27(35(29)18-4-8-23-6-2-16-32-20-23)10-1-11-28(30)36-19-5-9-24-7-3-17-33-21-24/h1,10-15,23-24,32-33H,2-9,16-22H2 KWGDURXIKWPRNZ-UHFFFAOYSA-N 50065467 2-(4-Chloro-phenoxymethyl)-4-((S)-3-piperidin-3-yl-propoxy)-1-((R)-3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL90717 Neuropeptide Y receptor type 1 Homo sapiens 17 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065467 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065467&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10509290 103960369 CHEMBL90717 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112725 Cn1c(COc2ccc(Cl)cc2)c(CN2CCCCC2)c2ccccc12 InChI=1S/C22H25ClN2O/c1-24-21-8-4-3-7-19(21)20(15-25-13-5-2-6-14-25)22(24)16-26-18-11-9-17(23)10-12-18/h3-4,7-12H,2,5-6,13-16H2,1H3 OUVHCTWMGVFCDT-UHFFFAOYSA-N 50060727 2-(4-Chloro-phenoxymethyl)-1-methyl-3-piperidin-1-ylmethyl-1H-indole::CHEMBL421549 Neuropeptide Y receptor type 1 Homo sapiens 2310 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50060727 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50060727&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10619067 103956363 CHEMBL421549 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112726 Clc1ccc(OCc2nc3c(OCCCC4CCCCN4)cccc3n2CCCC2CCCNC2)cc1 InChI=1S/C30H41ClN4O2/c31-24-13-15-26(16-14-24)37-22-29-34-30-27(35(29)19-5-8-23-7-4-17-32-21-23)11-3-12-28(30)36-20-6-10-25-9-1-2-18-33-25/h3,11-16,23,25,32-33H,1-2,4-10,17-22H2 MZDQVOUAJWXYFT-UHFFFAOYSA-N 50065477 2-(4-Chloro-phenoxymethyl)-4-(3-piperidin-2-yl-propoxy)-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL93535 Neuropeptide Y receptor type 1 Homo sapiens 16 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065477 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065477&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10605125 103960379 CHEMBL93535 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112727 Clc1ccc(OCc2nc3c(OCCC[C@H]4CCCNC4)cccc3n2CCC[C@H]2CCCNC2)cc1 InChI=1S/C30H41ClN4O2/c31-25-12-14-26(15-13-25)37-22-29-34-30-27(35(29)18-4-8-23-6-2-16-32-20-23)10-1-11-28(30)36-19-5-9-24-7-3-17-33-21-24/h1,10-15,23-24,32-33H,2-9,16-22H2 KWGDURXIKWPRNZ-UHFFFAOYSA-N 50065462 2-(4-Chloro-phenoxymethyl)-4-((R)-3-piperidin-3-yl-propoxy)-1-((R)-3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL92148 Neuropeptide Y receptor type 1 Homo sapiens 41 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065462 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065462&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10818866 103960364 CHEMBL92148 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112728 Clc1ccc(OCc2nc3c(OCCC4CCCCN4)cccc3n2CCCC2CCCNC2)cc1 InChI=1S/C29H39ClN4O2/c30-23-11-13-25(14-12-23)36-21-28-33-29-26(34(28)18-5-7-22-6-4-16-31-20-22)9-3-10-27(29)35-19-15-24-8-1-2-17-32-24/h3,9-14,22,24,31-32H,1-2,4-8,15-21H2 VPLRZVPDJKVALG-UHFFFAOYSA-N 50065479 2-(4-Chloro-phenoxymethyl)-4-(2-piperidin-2-yl-ethoxy)-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL92679 Neuropeptide Y receptor type 1 Homo sapiens 29 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065479 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065479&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10700181 103960381 CHEMBL92679 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112729 Clc1ccc(OCc2nc3ccccc3n2CCCC2CCCCN2)cc1 InChI=1S/C22H26ClN3O/c23-17-10-12-19(13-11-17)27-16-22-25-20-8-1-2-9-21(20)26(22)15-5-7-18-6-3-4-14-24-18/h1-2,8-13,18,24H,3-7,14-16H2 SUZGEAOMJKXUKB-UHFFFAOYSA-N 50065478 2-(4-Chloro-phenoxymethyl)-1-(3-piperidin-2-yl-propyl)-1H-benzoimidazole::CHEMBL330066 Neuropeptide Y receptor type 1 Homo sapiens 3230 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065478 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065478&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10791454 103960380 CHEMBL330066 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112730 Clc1ccc(OCc2nc3c(OCCCC4CCNCC4)cccc3n2CCCC2CCCNC2)cc1 InChI=1S/C30H41ClN4O2/c31-25-10-12-26(13-11-25)37-22-29-34-30-27(35(29)19-3-6-24-5-2-16-33-21-24)8-1-9-28(30)36-20-4-7-23-14-17-32-18-15-23/h1,8-13,23-24,32-33H,2-7,14-22H2 QLXBJIWDROVPHJ-UHFFFAOYSA-N 50065476 2-(4-Chloro-phenoxymethyl)-4-(3-piperidin-4-yl-propoxy)-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL328460 Neuropeptide Y receptor type 1 Homo sapiens 152 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065476 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065476&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10842778 103960378 CHEMBL328460 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112731 Clc1ccc(OCc2nc3ccccc3n2CCN2CCCCC2)cc1 InChI=1S/C21H24ClN3O/c22-17-8-10-18(11-9-17)26-16-21-23-19-6-2-3-7-20(19)25(21)15-14-24-12-4-1-5-13-24/h2-3,6-11H,1,4-5,12-16H2 WIJROCGFVQGECR-UHFFFAOYSA-N 50065480 2-(4-Chloro-phenoxymethyl)-1-(2-piperidin-1-yl-ethyl)-1H-benzoimidazole::CHEMBL93324 Neuropeptide Y receptor type 1 Homo sapiens >100000 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065480 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065480&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10809141 103960382 CHEMBL93324 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112732 Clc1ccc(OCc2nc3ccccc3n2CCCC2CCCNC2)cc1 InChI=1S/C22H26ClN3O/c23-18-9-11-19(12-10-18)27-16-22-25-20-7-1-2-8-21(20)26(22)14-4-6-17-5-3-13-24-15-17/h1-2,7-12,17,24H,3-6,13-16H2 IERFYIGMJQXNDH-UHFFFAOYSA-N 50065481 2-(4-Chloro-phenoxymethyl)-1-(3-piperidin-3-yl-propyl)-1H-benzoimidazole::CHEMBL91738 Neuropeptide Y receptor type 1 Homo sapiens 700 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065481&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10601376 103960383 CHEMBL91738 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112733 Clc1ccc(OCc2nc3ccccc3n2CCCN2CCCCC2)cc1 InChI=1S/C22H26ClN3O/c23-18-9-11-19(12-10-18)27-17-22-24-20-7-2-3-8-21(20)26(22)16-6-15-25-13-4-1-5-14-25/h2-3,7-12H,1,4-6,13-17H2 YUSPMXQHCNUCBA-UHFFFAOYSA-N 50065482 2-(4-Chloro-phenoxymethyl)-1-(3-piperidin-1-yl-propyl)-1H-benzoimidazole::CHEMBL316291 Neuropeptide Y receptor type 1 Homo sapiens 7020 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065482 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065482&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10786219 103960384 CHEMBL316291 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112734 Clc1ccc(OCc2nc3ccccc3n2CCCCC2CCCNC2)cc1 InChI=1S/C23H28ClN3O/c24-19-10-12-20(13-11-19)28-17-23-26-21-8-1-2-9-22(21)27(23)15-4-3-6-18-7-5-14-25-16-18/h1-2,8-13,18,25H,3-7,14-17H2 VSPYQKXDPIJDQS-UHFFFAOYSA-N 50065483 2-(4-Chloro-phenoxymethyl)-1-(4-piperidin-3-yl-butyl)-1H-benzoimidazole::CHEMBL90369 Neuropeptide Y receptor type 1 Homo sapiens 1210 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065483 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065483&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10815605 103960385 CHEMBL90369 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50112735 Clc1ccc(OCc2nc3ccccc3n2CCC2CCCCN2)cc1 InChI=1S/C21H24ClN3O/c22-16-8-10-18(11-9-16)26-15-21-24-19-6-1-2-7-20(19)25(21)14-12-17-5-3-4-13-23-17/h1-2,6-11,17,23H,3-5,12-15H2 OJXMFPOBPZXOPS-UHFFFAOYSA-N 50065484 2-(4-Chloro-phenoxymethyl)-1-(2-piperidin-2-yl-ethyl)-1H-benzoimidazole::CHEMBL330703 Neuropeptide Y receptor type 1 Homo sapiens 7860.0 ChEMBL 10.1021/jm9706630 10.7270/Q2TD9WGN 9667962 Zarrinmayeh, H; Nunes, AM; Ornstein, PL; Zimmerman, DM; Arnold, MB; Schober, DA; Gackenheimer, SL; Bruns, RF; Hipskind, PA; Britton, TC; Cantrell, BE; Gehlert, DR 8/3/1998 11/10/2009 Eli Lilly http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065484 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065484&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10719643 103960386 CHEMBL330703 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5