BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 1873 NC(=O)NC1=N[C@H](Cc2ccccc2)[C@H](O)[C@@H](O)[C@@H](Cc2ccccc2)N1 |r,t:4| InChI=1S/C20H24N4O3/c21-19(27)24-20-22-15(11-13-7-3-1-4-8-13)17(25)18(26)16(23-20)12-14-9-5-2-6-10-14/h1-10,15-18,25-26H,11-12H2,(H4,21,22,23,24,27) VMCPQSSQVUVWCH-UHFFFAOYSA-N 1685 [4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]urea::[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-diazepan-2-ylidene]urea::Cyclic Cyanoguanidine deriv. 8a Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 >12500 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1685 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1685&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 5327617 8031541 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1874 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-[#6]=[#6])\[#6](=[#7]/C#N)-[#7](-[#6]-[#6]=[#6])-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C26H14N4O2/c1-3-15-29-22(17-20-11-7-5-8-12-20)24(31)25(32)23(18-21-13-9-6-10-14-21)30(16-4-2)26(29)28-19-27/h5-14,22-25H UCNWEAUMNVVDTE-UHFFFAOYSA-N 1686 [4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-1,3-di-2-propenyl-2H-1,3-diazepin-2-ylidene]cyanamide::{[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis(prop-2-en-1-yl)-1,3-diazepan-2-ylidene]amino}carbonitrile::Cyclic Cyanoguanidine deriv. 8b Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 37 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1686 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1686&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469292 8031542 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1875 [#6]-[#6]-[#6]-[#7]1-[#6@H](-[#6]-c2ccccc2)-[#6@H](-[#8])-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-[#6]-[#6])\[#6]-1=[#7]\C#N |r| InChI=1S/C26H14N4O2/c1-3-15-29-22(17-20-11-7-5-8-12-20)24(31)25(32)23(18-21-13-9-6-10-14-21)30(16-4-2)26(29)28-19-27/h5-14,22-25H UCNWEAUMNVVDTE-UHFFFAOYSA-N 1687 {[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-dipropyl-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-1,3-dipropyl-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8c Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 14 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1687 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1687&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469293 8031543 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1876 [#6]-[#6]-[#6]-[#6]-[#7]1-[#6@H](-[#6]-c2ccccc2)-[#6@H](-[#8])-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-[#6]-[#6]-[#6])\[#6]-1=[#7]\C#N |r| InChI=1S/C28H14N4O2/c1-3-5-17-31-24(19-22-13-9-7-10-14-22)26(33)27(34)25(20-23-15-11-8-12-16-23)32(18-6-4-2)28(31)30-21-29/h7-16,24-27H WONGODPHSOYEIA-UHFFFAOYSA-N 1688 {[(4R,5S,6S,7R)-4,7-dibenzyl-1,3-dibutyl-5,6-dihydroxy-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[1,3-Dibutylhexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8d Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 2.7 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1688 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1688&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469294 8031544 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1877 [#6]\[#6](-[#6])=[#6]\[#6]-[#7]1-[#6@H](-[#6]-c2ccccc2)-[#6@H](-[#8])-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]\[#6]=[#6](\[#6])-[#6])\[#6]-1=[#7]\C#N |r| InChI=1S/C30H14N4O2/c1-22(2)15-17-33-26(19-24-11-7-5-8-12-24)28(35)29(36)27(20-25-13-9-6-10-14-25)34(18-16-23(3)4)30(33)32-21-31/h5-14,26-29H MMIDPHMGUKYQOD-UHFFFAOYSA-N 1689 [4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3-bis(3-methyl-2-butenyl)-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::{[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis(3-methylbut-2-en-1-yl)-1,3-diazepan-2-ylidene]amino}carbonitrile::Cyclic Cyanoguanidine deriv. 8e Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 30 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1689 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1689&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469295 8031545 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1878 [#6]-[#6](-[#6])-[#6]-[#6]-[#7]1-[#6@H](-[#6]-c2ccccc2)-[#6@H](-[#8])-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-[#6]-[#6](-[#6])-[#6])\[#6]-1=[#7]\C#N |r| InChI=1S/C30H14N4O2/c1-22(2)15-17-33-26(19-24-11-7-5-8-12-24)28(35)29(36)27(20-25-13-9-6-10-14-25)34(18-16-23(3)4)30(33)32-21-31/h5-14,26-29H MMIDPHMGUKYQOD-UHFFFAOYSA-N 1690 [4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3-bis(3-methylbutyl)-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::{[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis(3-methylbutyl)-1,3-diazepan-2-ylidene]amino}carbonitrile::Cyclic Cyanoguanidine deriv. 8f Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 3.8 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1690 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1690&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469296 8031546 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1879 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-[#6]-2-[#6]-[#6]-2)\[#6](=[#7]/C#N)-[#7](-[#6]-[#6]-2-[#6]-[#6]-2)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C28H14N4O2/c29-19-30-28-31(17-22-11-12-22)24(15-20-7-3-1-4-8-20)26(33)27(34)25(32(28)18-23-13-14-23)16-21-9-5-2-6-10-21/h1-10,24-27H FJUYSORXWLDIDJ-UHFFFAOYSA-N 1691 [4R-(4a,5a,6B,7B)]-[1,3-Bis(cyclopropylmethyl)hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::{[(4R,5S,6S,7R)-4,7-dibenzyl-1,3-bis(cyclopropylmethyl)-5,6-dihydroxy-1,3-diazepan-2-ylidene]amino}carbonitrile::Cyclic Cyanoguanidine deriv. 8g Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 22 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1691 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1691&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469297 8031547 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1880 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-[#6]-2-[#6]-[#6]-[#6]-2)\[#6](=[#7]/C#N)-[#7](-[#6]-[#6]-2-[#6]-[#6]-[#6]-2)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C30H14N4O2/c31-21-32-30-33(19-24-13-7-14-24)26(17-22-9-3-1-4-10-22)28(35)29(36)27(18-23-11-5-2-6-12-23)34(30)20-25-15-8-16-25/h1-6,9-12,26-29H OIYLPPVYTJDFSE-UHFFFAOYSA-N 1692 [4R-(4a,5a,6B,7B)]-[1,3-Bis(cyclobutylmethyl)hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::{[(4R,5S,6S,7R)-4,7-dibenzyl-1,3-bis(cyclobutylmethyl)-5,6-dihydroxy-1,3-diazepan-2-ylidene]amino}carbonitrile::Cyclic Cyanoguanidine deriv. 8h Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 2 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1692 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1692&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469298 8031548 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1881 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-[#6]-2-[#6]-[#6]-[#6]-[#6]-2)\[#6](=[#7]/C#N)-[#7](-[#6]-[#6]-2-[#6]-[#6]-[#6]-[#6]-2)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C32H14N4O2/c33-23-34-32-35(21-26-15-7-8-16-26)28(19-24-11-3-1-4-12-24)30(37)31(38)29(20-25-13-5-2-6-14-25)36(32)22-27-17-9-10-18-27/h1-6,11-14,28-31H MAJUDBQQKRYSND-UHFFFAOYSA-N 1693 {[(4R,5S,6S,7R)-4,7-dibenzyl-1,3-bis(cyclopentylmethyl)-5,6-dihydroxy-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[1,3-Bis(cyclopentylmethyl)hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8i Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 1.5 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1693 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1693&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469299 8031549 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1882 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-[#6]-2-[#6]-[#6]-[#6]-[#6]-[#6]-2)\[#6](=[#7]/C#N)-[#7](-[#6]-[#6]-2-[#6]-[#6]-[#6]-[#6]-[#6]-2)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C34H14N4O2/c35-25-36-34-37(23-28-17-9-3-10-18-28)30(21-26-13-5-1-6-14-26)32(39)33(40)31(22-27-15-7-2-8-16-27)38(34)24-29-19-11-4-12-20-29/h1-2,5-8,13-16,30-33H BUVHGUHNJBHOAI-UHFFFAOYSA-N 1694 {[(4R,5S,6S,7R)-4,7-dibenzyl-1,3-bis(cyclohexylmethyl)-5,6-dihydroxy-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[1,3-Bis(cyclohexylmethyl)hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8j Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 5.7 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1694 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1694&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469300 8031550 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1883 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-c2ccccc2)\[#6](=[#7]/C#N)-[#7](-[#6]-c2ccccc2)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C34H24N4O2/c35-25-36-34-37(23-28-17-9-3-10-18-28)30(21-26-13-5-1-6-14-26)32(39)33(40)31(22-27-15-7-2-8-16-27)38(34)24-29-19-11-4-12-20-29/h1-20,30-33H UCAMKIBXFXMYMH-UHFFFAOYSA-N 1695 [4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3,4,7-tetrakis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::{[(4R,5S,6S,7R)-1,3,4,7-tetrabenzyl-5,6-dihydroxy-1,3-diazepan-2-ylidene]amino}carbonitrile::Cyclic Cyanoguanidine deriv. 8k Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 20 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1695 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1695&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469301 8031551 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1884 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-c2cccc(c2)-[#7+](-[#8-])=O)\[#6](=[#7]/C#N)-[#7](-[#6]-c2cccc(c2)-[#7+](-[#8-])=O)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C34H22N6O6/c35-23-36-34-37(21-26-13-7-15-28(17-26)39(43)44)30(19-24-9-3-1-4-10-24)32(41)33(42)31(20-25-11-5-2-6-12-25)38(34)22-27-14-8-16-29(18-27)40(45)46/h1-18,30-33H JKXBITWVIMGRKW-UHFFFAOYSA-N 1696 {[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis[(3-nitrophenyl)methyl]-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3-bis[(3-nitrophenyl)methyl]-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8l Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 89 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1696 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1696&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469302 8031552 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1885 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-c2ccc(cc2)-[#7+](-[#8-])=O)\[#6](=[#7]/C#N)-[#7](-[#6]-c2ccc(cc2)-[#7+](-[#8-])=O)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C34H22N6O6/c35-23-36-34-37(21-26-11-15-28(16-12-26)39(43)44)30(19-24-7-3-1-4-8-24)32(41)33(42)31(20-25-9-5-2-6-10-25)38(34)22-27-13-17-29(18-14-27)40(45)46/h1-18,30-33H ZYUYJPLAOWANID-UHFFFAOYSA-N 1697 {[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis[(4-nitrophenyl)methyl]-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3-bis[(4-nitrophenyl)methyl]-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8m Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 67 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1697 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1697&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469303 8031553 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1886 [#7]-c1cccc(-[#6]-[#7]2-[#6@H](-[#6]-c3ccccc3)-[#6@H](-[#8])-[#6@@H](-[#8])-[#6@@H](-[#6]-c3ccccc3)-[#7](-[#6]-c3cccc(-[#7])c3)\[#6]-2=[#7]/C#N)c1 |r| InChI=1S/C34H22N6O2/c35-23-38-34-39(21-26-13-7-15-28(36)17-26)30(19-24-9-3-1-4-10-24)32(41)33(42)31(20-25-11-5-2-6-12-25)40(34)22-27-14-8-16-29(37)18-27/h1-18,30-33H LEWNRZHHLQXAKU-UHFFFAOYSA-N 1698 {[(4R,5S,6S,7R)-1,3-bis[(3-aminophenyl)methyl]-4,7-dibenzyl-5,6-dihydroxy-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[1,3-Bis[(3-aminophenyl)methyl]hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8n Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 7.4 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1698 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1698&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469304 8031554 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1887 [#7]-c1ccc(-[#6]-[#7]2-[#6@H](-[#6]-c3ccccc3)-[#6@H](-[#8])-[#6@@H](-[#8])-[#6@@H](-[#6]-c3ccccc3)-[#7](-[#6]-c3ccc(-[#7])cc3)\[#6]-2=[#7]\C#N)cc1 |r| InChI=1S/C34H22N6O2/c35-23-38-34-39(21-26-11-15-28(36)16-12-26)30(19-24-7-3-1-4-8-24)32(41)33(42)31(20-25-9-5-2-6-10-25)40(34)22-27-13-17-29(37)18-14-27/h1-18,30-33H UWRCTSZJLNJYLK-UHFFFAOYSA-N 1699 {[(4R,5S,6S,7R)-1,3-bis[(4-aminophenyl)methyl]-4,7-dibenzyl-5,6-dihydroxy-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[1,3-Bis[(4-aminophenyl)methyl]hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8o Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 25 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1699 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1699&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469305 8031555 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1888 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-c2cccc(c2)C#N)\[#6](=[#7]/C#N)-[#7](-[#6]-c2cccc(c2)C#N)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C36H22N6O2/c37-21-28-13-7-15-30(17-28)23-41-32(19-26-9-3-1-4-10-26)34(43)35(44)33(20-27-11-5-2-6-12-27)42(36(41)40-25-39)24-31-16-8-14-29(18-31)22-38/h1-18,32-35H GMYKHRCCXYAWGH-UHFFFAOYSA-N 1700 3-{[(4R,5S,6S,7R)-4,7-dibenzyl-2-(cyanoimino)-3-[(3-cyanophenyl)methyl]-5,6-dihydroxy-1,3-diazepan-1-yl]methyl}benzonitrile::[4R-(4a,5a,6B,7B)]-[1,3-Bis[(3-cyanophenyl)methyl]hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8p Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 27 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1700 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1700&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469306 8031556 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1889 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-c2ccc(cc2)C#N)\[#6](=[#7]/C#N)-[#7](-[#6]-c2ccc(cc2)C#N)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C36H22N6O2/c37-21-28-11-15-30(16-12-28)23-41-32(19-26-7-3-1-4-8-26)34(43)35(44)33(20-27-9-5-2-6-10-27)42(36(41)40-25-39)24-31-17-13-29(22-38)14-18-31/h1-18,32-35H GPJMCHLLFOEUDA-UHFFFAOYSA-N 1701 [4R-(4a,5a,6B,7B)]-[1,3-Bis[(4-cyanophenyl)methyl]hexahydro-5,6-dihydroxy-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::4-{[(4R,5S,6S,7R)-4,7-dibenzyl-2-(cyanoimino)-3-[(4-cyanophenyl)methyl]-5,6-dihydroxy-1,3-diazepan-1-yl]methyl}benzonitrile::Cyclic Cyanoguanidine deriv. 8q Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 128 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1701 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1701&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469307 8031557 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1890 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-c2cccc(-[#8])c2)\[#6](=[#7]/C#N)-[#7](-[#6]-c2cccc(-[#8])c2)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C34H22N4O4/c35-23-36-34-37(21-26-13-7-15-28(39)17-26)30(19-24-9-3-1-4-10-24)32(41)33(42)31(20-25-11-5-2-6-12-25)38(34)22-27-14-8-16-29(40)18-27/h1-18,30-33H HEQKANSNNRHSNF-UHFFFAOYSA-N 1702 {[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis[(3-hydroxyphenyl)methyl]-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3-bis[(3-hydroxyphenyl)methyl]-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8r Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 0.72 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1702 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1702&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469308 8031558 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1891 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-c2ccc(-[#8])cc2)\[#6](=[#7]/C#N)-[#7](-[#6]-c2ccc(-[#8])cc2)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C34H22N4O4/c35-23-36-34-37(21-26-11-15-28(39)16-12-26)30(19-24-7-3-1-4-8-24)32(41)33(42)31(20-25-9-5-2-6-10-25)38(34)22-27-13-17-29(40)18-14-27/h1-18,30-33H WVUSDHSTYBXINX-UHFFFAOYSA-N 1703 {[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis[(4-hydroxyphenyl)methyl]-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3-bis[(4-hydroxyphenyl)methyl]-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8s Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 2.6 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1703 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1703&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469309 8031559 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1892 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-c2cccc(-[#8]-[#6]-c3ccccc3)c2)\[#6](=[#7]/C#N)-[#7](-[#6]-c2cccc(-[#8]-[#6]-c3ccccc3)c2)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C48H32N4O4/c49-35-50-48-51(31-40-23-13-25-42(27-40)55-33-38-19-9-3-10-20-38)44(29-36-15-5-1-6-16-36)46(53)47(54)45(30-37-17-7-2-8-18-37)52(48)32-41-24-14-26-43(28-41)56-34-39-21-11-4-12-22-39/h1-28,44-47H FQOSPMVTVLSTIQ-UHFFFAOYSA-N 1704 [4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3-bis[[3-(phenylmethoxy)phenyl]methyl]-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::{[(4R,5S,6S,7R)-4,7-dibenzyl-1,3-bis({[3-(benzyloxy)phenyl]methyl})-5,6-dihydroxy-1,3-diazepan-2-ylidene]amino}carbonitrile::Cyclic Cyanoguanidine deriv. 8t Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 1370 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1704 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1704&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469310 8031560 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1893 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-c2ccc(-[#8]-[#6]-c3ccccc3)cc2)\[#6](=[#7]/C#N)-[#7](-[#6]-c2ccc(-[#8]-[#6]-c3ccccc3)cc2)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C48H32N4O4/c49-35-50-48-51(31-38-21-25-42(26-22-38)55-33-40-17-9-3-10-18-40)44(29-36-13-5-1-6-14-36)46(53)47(54)45(30-37-15-7-2-8-16-37)52(48)32-39-23-27-43(28-24-39)56-34-41-19-11-4-12-20-41/h1-28,44-47H LQQOJCGCOJJMMS-UHFFFAOYSA-N 1705 [4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3-bis[[4-(phenylmethoxy)phenyl]methyl]-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::{[(4R,5S,6S,7R)-4,7-dibenzyl-1,3-bis({[4-(benzyloxy)phenyl]methyl})-5,6-dihydroxy-1,3-diazepan-2-ylidene]amino}carbonitrile::Cyclic Cyanoguanidine deriv. 8u Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 900 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1705 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1705&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469311 8031561 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1894 [#8]-[#6]-c1cccc(-[#6]-[#7]2-[#6@H](-[#6]-c3ccccc3)-[#6@H](-[#8])-[#6@@H](-[#8])-[#6@@H](-[#6]-c3ccccc3)-[#7](-[#6]-c3cccc(-[#6]-[#8])c3)\[#6]-2=[#7]\C#N)c1 |r| InChI=1S/C36H22N4O4/c37-25-38-36-39(21-28-13-7-15-30(17-28)23-41)32(19-26-9-3-1-4-10-26)34(43)35(44)33(20-27-11-5-2-6-12-27)40(36)22-29-14-8-16-31(18-29)24-42/h1-18,32-35H AOHILKRGEJDANE-UHFFFAOYSA-N 1706 [4R-(4a,5a,6b,7b)]-[Hexahydro-5,6-dihydroxy-1,3-bis[[3-(hydroxymethyl)phenyl]methyl]-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::{[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis({[3-(hydroxymethyl)phenyl]methyl})-1,3-diazepan-2-ylidene]amino}carbonitrile::Cyclic Cyanoguanidine deriv. 8v Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 1.7 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1706 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1706&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469312 8031562 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1895 [#8]-[#6]-c1ccc(-[#6]-[#7]2-[#6@H](-[#6]-c3ccccc3)-[#6@H](-[#8])-[#6@@H](-[#8])-[#6@@H](-[#6]-c3ccccc3)-[#7](-[#6]-c3ccc(-[#6]-[#8])cc3)\[#6]-2=[#7]\C#N)cc1 |r| InChI=1S/C36H22N4O4/c37-25-38-36-39(21-28-11-15-30(23-41)16-12-28)32(19-26-7-3-1-4-8-26)34(43)35(44)33(20-27-9-5-2-6-10-27)40(36)22-29-13-17-31(24-42)18-14-29/h1-18,32-35H FYWRFEDYXVLCQU-UHFFFAOYSA-N 1707 {[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis({[4-(hydroxymethyl)phenyl]methyl})-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3-bis[[4-(hydroxymethoxy)phenyl]methyl]-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8w Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 11 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1707 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1707&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469313 8031563 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1896 [#8]-[#6@@H]-1-[#6@@H](-[#8])-[#6@@H](-[#6]-c2ccccc2)-[#7](-[#6]-c2ccc3ccccc3c2)\[#6](=[#7]/C#N)-[#7](-[#6]-c2ccc3ccccc3c2)-[#6@@H]-1-[#6]-c1ccccc1 |r| InChI=1S/C42H28N4O2/c43-29-44-42-45(27-32-19-21-34-15-7-9-17-36(34)23-32)38(25-30-11-3-1-4-12-30)40(47)41(48)39(26-31-13-5-2-6-14-31)46(42)28-33-20-22-35-16-8-10-18-37(35)24-33/h1-24,38-41H UWOZYBFPIFZXOE-UHFFFAOYSA-N 1708 {[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis(naphthalen-2-ylmethyl)-1,3-diazepan-2-ylidene]amino}carbonitrile::[4R-(4a,5a,6B,7B)]-[Hexahydro-5,6-dihydroxy-1,3-bis(2-naphthalenylmethyl)-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-ylidene]cyanamide::Cyclic Cyanoguanidine deriv. 8x Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 22 5.5000 37.00 C Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1708 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1708&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 470100 8031564 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1897 O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)NC(=O)N[C@@H]1Cc1ccccc1 |r| InChI=1S/C19H22N2O3/c22-17-15(11-13-7-3-1-4-8-13)20-19(24)21-16(18(17)23)12-14-9-5-2-6-10-14/h1-10,15-18,22-23H,11-12H2,(H2,20,21,24) HMELFROOXUXFER-UHFFFAOYSA-N 1709 (4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-diazepan-2-one::Cyclic Urea deriv. 9a Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 267 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1709 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1709&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 454189 8031565 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1908 O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2cccc(c2)[N+]([O-])=O)C(=O)N(Cc2cccc(c2)[N+]([O-])=O)[C@@H]1Cc1ccccc1 |r| InChI=1S/C33H32N4O7/c38-31-29(19-23-9-3-1-4-10-23)34(21-25-13-7-15-27(17-25)36(41)42)33(40)35(22-26-14-8-16-28(18-26)37(43)44)30(32(31)39)20-24-11-5-2-6-12-24/h1-18,29-32,38-39H,19-22H2 ZWDOWGPELPEFCT-UHFFFAOYSA-N 1720 CHEMBL415040::(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis[(3-nitrophenyl)methyl]-1,3-diazepan-2-one::Cyclic Urea deriv. 9l Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 2.8 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1720 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1720&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 463362 8031575 CHEMBL415040 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1909 O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2ccc(cc2)[N+]([O-])=O)C(=O)N(Cc2ccc(cc2)[N+]([O-])=O)[C@@H]1Cc1ccccc1 |r| InChI=1S/C33H32N4O7/c38-31-29(19-23-7-3-1-4-8-23)34(21-25-11-15-27(16-12-25)36(41)42)33(40)35(22-26-13-17-28(18-14-26)37(43)44)30(32(31)39)20-24-9-5-2-6-10-24/h1-18,29-32,38-39H,19-22H2 JCWGHTCTGWEHIZ-UHFFFAOYSA-N 1721 (4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis[(4-nitrophenyl)methyl]-1,3-diazepan-2-one::Cyclic Urea deriv. 9m Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 32 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1721 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1721&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469347 8031576 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1911 Nc1ccc(CN2[C@H](Cc3ccccc3)[C@H](O)[C@@H](O)[C@@H](Cc3ccccc3)N(Cc3ccc(N)cc3)C2=O)cc1 |r| InChI=1S/C33H36N4O3/c34-27-15-11-25(12-16-27)21-36-29(19-23-7-3-1-4-8-23)31(38)32(39)30(20-24-9-5-2-6-10-24)37(33(36)40)22-26-13-17-28(35)18-14-26/h1-18,29-32,38-39H,19-22,34-35H2 OERDKWNDHLFCDM-UHFFFAOYSA-N 1723 (4R,5S,6S,7R)-1,3-bis[(4-aminophenyl)methyl]-4,7-dibenzyl-5,6-dihydroxy-1,3-diazepan-2-one::Cyclic Urea deriv. 9o Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 1.1 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1723 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1723&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469348 8031578 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1912 O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2cccc(c2)C#N)C(=O)N(Cc2cccc(c2)C#N)[C@@H]1Cc1ccccc1 |r| InChI=1S/C35H32N4O3/c36-21-27-13-7-15-29(17-27)23-38-31(19-25-9-3-1-4-10-25)33(40)34(41)32(20-26-11-5-2-6-12-26)39(35(38)42)24-30-16-8-14-28(18-30)22-37/h1-18,31-34,40-41H,19-20,23-24H2 YHSHWUKUIKBKFJ-UHFFFAOYSA-N 1724 3-{[(4R,5S,6S,7R)-4,7-dibenzyl-3-[(3-cyanophenyl)methyl]-5,6-dihydroxy-2-oxo-1,3-diazepan-1-yl]methyl}benzonitrile::Cyclic Urea deriv. 9p Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 3.0 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1724 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1724&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469349 8031579 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1913 O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2ccc(cc2)C#N)C(=O)N(Cc2ccc(cc2)C#N)[C@@H]1Cc1ccccc1 |r| InChI=1S/C35H32N4O3/c36-21-27-11-15-29(16-12-27)23-38-31(19-25-7-3-1-4-8-25)33(40)34(41)32(20-26-9-5-2-6-10-26)39(35(38)42)24-30-17-13-28(22-37)14-18-30/h1-18,31-34,40-41H,19-20,23-24H2 DZSRMEJOWXVYNO-UHFFFAOYSA-N 1725 4-{[(4R,5S,6S,7R)-4,7-dibenzyl-3-[(4-cyanophenyl)methyl]-5,6-dihydroxy-2-oxo-1,3-diazepan-1-yl]methyl}benzonitrile::Cyclic Urea deriv. 9q Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 52 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1725 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1725&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469350 8031580 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1914 O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2cccc(O)c2)C(=O)N(Cc2cccc(O)c2)[C@@H]1Cc1ccccc1 |r| InChI=1S/C33H34N2O5/c36-27-15-7-13-25(17-27)21-34-29(19-23-9-3-1-4-10-23)31(38)32(39)30(20-24-11-5-2-6-12-24)35(33(34)40)22-26-14-8-16-28(37)18-26/h1-18,29-32,36-39H,19-22H2 WEOXFVJLLOSYHC-UHFFFAOYSA-N 1726 CHEMBL284136::(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis[(3-hydroxyphenyl)methyl]-1,3-diazepan-2-one::Cyclic Urea deriv. 9r Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 0.12 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1726 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1726&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 463366 8031581 CHEMBL284136 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1915 O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2ccc(O)cc2)C(=O)N(Cc2ccc(O)cc2)[C@@H]1Cc1ccccc1 |r| InChI=1S/C33H34N2O5/c36-27-15-11-25(12-16-27)21-34-29(19-23-7-3-1-4-8-23)31(38)32(39)30(20-24-9-5-2-6-10-24)35(33(34)40)22-26-13-17-28(37)18-14-26/h1-18,29-32,36-39H,19-22H2 YCDGAESMEYQMIE-UHFFFAOYSA-N 1727 CHEMBL35860::(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis[(4-hydroxyphenyl)methyl]-1,3-diazepan-2-one::Cyclic Urea deriv. 9s Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 0.12 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1727 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1727&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 463364 8031582 CHEMBL35860 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1916 O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2cccc(OCc3ccccc3)c2)C(=O)N(Cc2cccc(OCc3ccccc3)c2)[C@@H]1Cc1ccccc1 |r| InChI=1S/C47H46N2O5/c50-45-43(29-35-15-5-1-6-16-35)48(31-39-23-13-25-41(27-39)53-33-37-19-9-3-10-20-37)47(52)49(44(46(45)51)30-36-17-7-2-8-18-36)32-40-24-14-26-42(28-40)54-34-38-21-11-4-12-22-38/h1-28,43-46,50-51H,29-34H2 VSVHKZYWVMTITO-UHFFFAOYSA-N 1728 (4R,5S,6S,7R)-4,7-dibenzyl-1,3-bis({[3-(benzyloxy)phenyl]methyl})-5,6-dihydroxy-1,3-diazepan-2-one::Cyclic Urea deriv. 9t Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 340 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1728 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1728&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469351 8031583 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1917 O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2ccc(OCc3ccccc3)cc2)C(=O)N(Cc2ccc(OCc3ccccc3)cc2)[C@@H]1Cc1ccccc1 |r| InChI=1S/C47H46N2O5/c50-45-43(29-35-13-5-1-6-14-35)48(31-37-21-25-41(26-22-37)53-33-39-17-9-3-10-18-39)47(52)49(44(46(45)51)30-36-15-7-2-8-16-36)32-38-23-27-42(28-24-38)54-34-40-19-11-4-12-20-40/h1-28,43-46,50-51H,29-34H2 KIJBIRLBDZTICZ-UHFFFAOYSA-N 1729 (4R,5S,6S,7R)-4,7-dibenzyl-1,3-bis({[4-(benzyloxy)phenyl]methyl})-5,6-dihydroxy-1,3-diazepan-2-one::Cyclic Urea deriv. 9u Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 542 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1729 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1729&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 469352 8031584 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 1918 OCc1cccc(CN2[C@H](Cc3ccccc3)[C@H](O)[C@@H](O)[C@@H](Cc3ccccc3)N(Cc3cccc(CO)c3)C2=O)c1 |r| InChI=1S/C35H38N2O5/c38-23-29-15-7-13-27(17-29)21-36-31(19-25-9-3-1-4-10-25)33(40)34(41)32(20-26-11-5-2-6-12-26)37(35(36)42)22-28-14-8-16-30(18-28)24-39/h1-18,31-34,38-41H,19-24H2 VPFBCSZFKQTTKA-UHFFFAOYSA-N 1730 (4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis({[3-(hydroxymethyl)phenyl]methyl})-1,3-diazepan-2-one::CHEMBL285417::Cyclic Urea deriv. 9v Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 0.14 Curated from the literature by BindingDB 10.1021/jm970524i 10.7270/Q2K935QM 9554878 aid1795337 Jadhav, PK; Woerner, FJ; Lam, PY; Hodge, CN; Eyermann, CJ; Man, HW; Daneker, WF; Bacheler, LT; Rayner, MM; Meek, JL; Erickson-Viitanen, S; Jackson, DA; Calabrese, JC; Schadt, M; Chang, CH 4/23/1998 10/19/2004 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1730 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=57&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1730&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 462242 8031585 CHEMBL285417 C15662 1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1ODW,1HXB,1HIV,1G6L Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5