BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50056418 Cn1c(COc2cccc(c2)-c2cc(=O)c3cc(Br)cc(C(O)=O)c3o2)nc2ccccc12 InChI=1S/C25H17BrN2O5/c1-28-20-8-3-2-7-19(20)27-23(28)13-32-16-6-4-5-14(9-16)22-12-21(29)17-10-15(26)11-18(25(30)31)24(17)33-22/h2-12H,13H2,1H3,(H,30,31) SDVHCZWEIFMGPB-UHFFFAOYSA-N 50064070 6-Bromo-2-[3-(1-methyl-1H-benzoimidazol-2-ylmethoxy)-phenyl]-4-oxo-4H-chromene-8-carboxylic acid::CHEMBL33331 Cysteinyl leukotriene receptor 1 Cavia porcellus 210 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064070 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064070&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10577476 103959170 CHEMBL33331 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056419 OC(=O)c1cc(Br)cc2c1oc(cc2=O)-c1cccc(OCc2ccc3ccc(Cl)cc3n2)c1 InChI=1S/C26H15BrClNO5/c27-16-9-20-23(30)12-24(34-25(20)21(10-16)26(31)32)15-2-1-3-19(8-15)33-13-18-7-5-14-4-6-17(28)11-22(14)29-18/h1-12H,13H2,(H,31,32) XECXOJPPICXVHU-UHFFFAOYSA-N 50064078 6-Bromo-2-[3-(7-chloro-quinolin-2-ylmethoxy)-phenyl]-4-oxo-4H-chromene-8-carboxylic acid::6-bromo-2-(3-((7-chloroquinolin-2-yl)methoxy)phenyl)-4-oxo-4H-chromene-8-carboxylic acid::CHEMBL33729 Cysteinyl leukotriene receptor 1 Cavia porcellus 12 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064078 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064078&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10792471 103959178 CHEMBL33729 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056420 OC(=O)c1cc(Br)cc2c1oc(cc2=O)-c1cccc(OCc2nc3ccccc3s2)c1 InChI=1S/C24H14BrNO5S/c25-14-9-16-19(27)11-20(31-23(16)17(10-14)24(28)29)13-4-3-5-15(8-13)30-12-22-26-18-6-1-2-7-21(18)32-22/h1-11H,12H2,(H,28,29) BZNPRZMJMTTYCW-UHFFFAOYSA-N 50064066 2-[3-(Benzothiazol-2-ylmethoxy)-phenyl]-6-bromo-4-oxo-4H-chromene-8-carboxylic acid::CHEMBL287559 Cysteinyl leukotriene receptor 1 Cavia porcellus 79 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064066 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064066&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10553667 103959166 CHEMBL287559 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056421 OC(=O)c1cccc2c1oc(cc2=O)-c1ccc(\C=C\c2ccc3ccccc3n2)cc1 InChI=1S/C27H17NO4/c29-24-16-25(32-26-21(24)5-3-6-22(26)27(30)31)19-11-8-17(9-12-19)10-14-20-15-13-18-4-1-2-7-23(18)28-20/h1-16H,(H,30,31) BXKLQYGWQGOBDG-UHFFFAOYSA-N 50064077 4-oxo-2-(4-(2-(quinolin-2-yl)vinyl)phenyl)-4H-chromene-8-carboxylic acid::4-Oxo-2-[4-((E)-2-quinolin-2-yl-vinyl)-phenyl]-4H-chromene-8-carboxylic acid::CHEMBL32764 Cysteinyl leukotriene receptor 1 Cavia porcellus 270 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064077 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064077&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10502162 103959177 CHEMBL32764 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056422 OC(=O)c1cc(F)cc2c1oc(cc2=O)-c1cccc(\C=C\c2ccc3ccccc3n2)c1 InChI=1S/C27H16FNO4/c28-19-13-21-24(30)15-25(33-26(21)22(14-19)27(31)32)18-6-3-4-16(12-18)8-10-20-11-9-17-5-1-2-7-23(17)29-20/h1-15H,(H,31,32) VOGZSQACUKGOTG-UHFFFAOYSA-N 50064075 6-Fluoro-4-oxo-2-[3-((E)-2-quinolin-2-yl-vinyl)-phenyl]-4H-chromene-8-carboxylic acid::CHEMBL284730 Cysteinyl leukotriene receptor 1 Cavia porcellus 127 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064075 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064075&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10717827 103959175 CHEMBL284730 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056423 OC(=O)c1cc(Br)cc2c1oc(cc2=O)-c1ccc(OCc2ccc3ccccc3n2)cc1 InChI=1S/C26H16BrNO5/c27-17-11-20-23(29)13-24(33-25(20)21(12-17)26(30)31)16-6-9-19(10-7-16)32-14-18-8-5-15-3-1-2-4-22(15)28-18/h1-13H,14H2,(H,30,31) UNQXXMZZUHJCSQ-UHFFFAOYSA-N 50064067 6-Bromo-4-oxo-2-[4-(quinolin-2-ylmethoxy)-phenyl]-4H-chromene-8-carboxylic acid::6-bromo-4-oxo-2-(4-(quinolin-2-ylmethoxy)phenyl)-4H-chromene-8-carboxylic acid::CHEMBL34507 Cysteinyl leukotriene receptor 1 Cavia porcellus 504 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064067 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064067&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10649109 103959167 CHEMBL34507 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056424 Cc1cc(C(O)=O)c2oc(cc(=O)c2c1)-c1cccc(\C=C\c2ccc3ccccc3n2)c1 InChI=1S/C28H19NO4/c1-17-13-22-25(30)16-26(33-27(22)23(14-17)28(31)32)20-7-4-5-18(15-20)9-11-21-12-10-19-6-2-3-8-24(19)29-21/h2-16H,1H3,(H,31,32) WDOJBYUAZDERPP-UHFFFAOYSA-N 50064060 6-Methyl-4-oxo-2-[3-((E)-2-quinolin-2-yl-vinyl)-phenyl]-4H-chromene-8-carboxylic acid::6-methyl-4-oxo-2-(3-(2-(quinolin-2-yl)vinyl)phenyl)-4H-chromene-8-carboxylic acid::CHEMBL34835 Cysteinyl leukotriene receptor 1 Cavia porcellus 13 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064060 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064060&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10765224 103959160 CHEMBL34835 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056425 OC(=O)c1cccc2c1oc(cc2=O)-c1ccc(OCc2ncc3ccccc3n2)cc1 InChI=1S/C25H16N2O5/c28-21-12-22(32-24-18(21)5-3-6-19(24)25(29)30)15-8-10-17(11-9-15)31-14-23-26-13-16-4-1-2-7-20(16)27-23/h1-13H,14H2,(H,29,30) AECCUSOSVDWESX-UHFFFAOYSA-N 50064069 4-Oxo-2-[4-(quinazolin-2-ylmethoxy)-phenyl]-4H-chromene-8-carboxylic acid::4-oxo-2-(4-(quinazolin-2-ylmethoxy)phenyl)-4H-chromene-8-carboxylic acid::CHEMBL417135 Cysteinyl leukotriene receptor 1 Cavia porcellus 1100 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064069 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064069&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10764782 103959169 CHEMBL417135 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056426 OC(=O)c1cc(Br)cc2c1oc(cc2=O)-c1cccc(OCc2ncc3ccccc3n2)c1 InChI=1S/C25H15BrN2O5/c26-16-9-18-21(29)11-22(33-24(18)19(10-16)25(30)31)14-5-3-6-17(8-14)32-13-23-27-12-15-4-1-2-7-20(15)28-23/h1-12H,13H2,(H,30,31) FEGCUSQYQHOKFE-UHFFFAOYSA-N 50064061 6-Bromo-4-oxo-2-[3-(quinazolin-2-ylmethoxy)-phenyl]-4H-chromene-8-carboxylic acid::6-bromo-4-oxo-2-(3-(quinazolin-2-ylmethoxy)phenyl)-4H-chromene-8-carboxylic acid::CHEMBL34740 Cysteinyl leukotriene receptor 1 Cavia porcellus 101 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064061 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064061&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10839186 103959161 CHEMBL34740 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056427 OC(=O)c1ccc2oc(cc(=O)c2c1)-c1cccc(\C=C\c2ccc3ccccc3n2)c1 InChI=1S/C27H17NO4/c29-24-16-26(32-25-13-10-20(27(30)31)15-22(24)25)19-6-3-4-17(14-19)8-11-21-12-9-18-5-1-2-7-23(18)28-21/h1-16H,(H,30,31) YKSLUJQRTVEPOZ-UHFFFAOYSA-N 50064079 4-Oxo-2-[3-((E)-2-quinolin-2-yl-vinyl)-phenyl]-4H-chromene-6-carboxylic acid::4-oxo-2-(3-(2-(quinolin-2-yl)vinyl)phenyl)-4H-chromene-6-carboxylic acid::CHEMBL33329 Cysteinyl leukotriene receptor 1 Cavia porcellus 408 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064079 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064079&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10598159 103959179 CHEMBL33329 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056428 OC(=O)c1cccc2c1oc(cc2=O)-c1cccc(\C=C\c2ccc3ccccc3n2)c1 InChI=1S/C27H17NO4/c29-24-16-25(32-26-21(24)8-4-9-22(26)27(30)31)19-7-3-5-17(15-19)11-13-20-14-12-18-6-1-2-10-23(18)28-20/h1-16H,(H,30,31) ZECLHDRRSBEUDJ-UHFFFAOYSA-N 50064074 4-Oxo-2-[3-((E)-2-quinolin-2-yl-vinyl)-phenyl]-4H-chromene-8-carboxylic acid::CHEMBL284624 Cysteinyl leukotriene receptor 1 Cavia porcellus 17 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064074 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064074&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10526098 103959174 CHEMBL284624 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056429 O=c1cc(oc2ccc(cc12)C#N)-c1cccc(\C=C\c2ccc3ccccc3n2)c1 InChI=1S/C27H16N2O2/c28-17-19-9-13-26-23(15-19)25(30)16-27(31-26)21-6-3-4-18(14-21)8-11-22-12-10-20-5-1-2-7-24(20)29-22/h1-16H ZRRORSMHTTVGLC-UHFFFAOYSA-N 50064082 4-oxo-2-(3-(2-(quinolin-2-yl)vinyl)phenyl)-4H-chromene-6-carbonitrile::4-Oxo-2-[3-((E)-2-quinolin-2-yl-vinyl)-phenyl]-4H-chromene-6-carbonitrile::CHEMBL33276 Cysteinyl leukotriene receptor 1 Cavia porcellus 1750 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064082 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064082&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10787157 103959182 CHEMBL33276 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056430 OC(=O)c1cc(Br)cc2c1oc(cc2=O)-c1cccc(OCc2ccc3ccccc3n2)c1 InChI=1S/C26H16BrNO5/c27-17-11-20-23(29)13-24(33-25(20)21(12-17)26(30)31)16-5-3-6-19(10-16)32-14-18-9-8-15-4-1-2-7-22(15)28-18/h1-13H,14H2,(H,30,31) RWSGESKPMHFVQG-UHFFFAOYSA-N 50064064 6-bromo-4-oxo-2-(3-(quinolin-2-ylmethoxy)phenyl)-4H-chromene-8-carboxylic acid::6-Bromo-4-oxo-2-[3-(quinolin-2-ylmethoxy)-phenyl]-4H-chromene-8-carboxylic acid::CHEMBL32138 Cysteinyl leukotriene receptor 1 Cavia porcellus 31 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064064 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064064&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10553494 103959164 CHEMBL32138 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056431 OC(=O)c1ccc2c(c1)oc(cc2=O)-c1cccc(\C=C\c2ccc3ccccc3n2)c1 InChI=1S/C27H17NO4/c29-24-16-25(32-26-15-20(27(30)31)10-13-22(24)26)19-6-3-4-17(14-19)8-11-21-12-9-18-5-1-2-7-23(18)28-21/h1-16H,(H,30,31) BWRCELQNWVOOHK-UHFFFAOYSA-N 50064073 4-Oxo-2-[3-((E)-2-quinolin-2-yl-vinyl)-phenyl]-4H-chromene-7-carboxylic acid::CHEMBL32944 Cysteinyl leukotriene receptor 1 Cavia porcellus 1730 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064073 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064073&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10764530 103959173 CHEMBL32944 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056432 OC(=O)c1cc(Br)cc2c1oc(cc2=O)-c1cccc(\C=C\c2ccc3ccccc3n2)c1 InChI=1S/C27H16BrNO4/c28-19-13-21-24(30)15-25(33-26(21)22(14-19)27(31)32)18-6-3-4-16(12-18)8-10-20-11-9-17-5-1-2-7-23(17)29-20/h1-15H,(H,31,32) GRXPSBPMPHAFEI-UHFFFAOYSA-N 50064068 6-bromo-4-oxo-2-(3-(2-(quinolin-2-yl)vinyl)phenyl)-4H-chromene-8-carboxylic acid::6-Bromo-4-oxo-2-[3-((E)-2-quinolin-2-yl-vinyl)-phenyl]-4H-chromene-8-carboxylic acid::CHEMBL32136 Cysteinyl leukotriene receptor 1 Cavia porcellus 17 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064068 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064068&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10767627 103959168 CHEMBL32136 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056433 OC(=O)c1cc(Cl)cc2c1oc(cc2=O)-c1cccc(\C=C\c2ccc3ccccc3n2)c1 InChI=1S/C27H16ClNO4/c28-19-13-21-24(30)15-25(33-26(21)22(14-19)27(31)32)18-6-3-4-16(12-18)8-10-20-11-9-17-5-1-2-7-23(17)29-20/h1-15H,(H,31,32) QIXHHLGHDFQCBP-UHFFFAOYSA-N 50064062 6-chloro-4-oxo-2-(3-(2-(quinolin-2-yl)vinyl)phenyl)-4H-chromene-8-carboxylic acid::6-Chloro-4-oxo-2-[3-((E)-2-quinolin-2-yl-vinyl)-phenyl]-4H-chromene-8-carboxylic acid::CHEMBL416769 Cysteinyl leukotriene receptor 1 Cavia porcellus 11 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064062 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064062&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 9890153 103959162 CHEMBL416769 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056434 Clc1cc(-c2nnn[nH]2)c2oc(cc(=O)c2c1)-c1cccc(C=Cc2ccc3ccccc3n2)c1 |w:23.26| InChI=1S/C27H16ClN5O2/c28-19-13-21-24(34)15-25(35-26(21)22(14-19)27-30-32-33-31-27)18-6-3-4-16(12-18)8-10-20-11-9-17-5-1-2-7-23(17)29-20/h1-15H,(H,30,31,32,33) XVDKUHZXVBXRTG-UHFFFAOYSA-N 50064063 6-Chloro-2-[3-((E)-2-quinolin-2-yl-vinyl)-phenyl]-8-(1H-tetrazol-5-yl)-chromen-4-one::CHEMBL33228 Cysteinyl leukotriene receptor 1 Cavia porcellus 11000 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064063 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064063&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15485487 103959163 CHEMBL33228 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056435 OC(=O)c1cccc2c1oc(cc2=O)-c1cccc(OCc2ccc3ccccc3n2)c1 InChI=1S/C26H17NO5/c28-23-14-24(32-25-20(23)8-4-9-21(25)26(29)30)17-6-3-7-19(13-17)31-15-18-12-11-16-5-1-2-10-22(16)27-18/h1-14H,15H2,(H,29,30) KHHUBZJYSQUQNW-UHFFFAOYSA-N 50064072 4-Oxo-2-[3-(quinolin-2-ylmethoxy)-phenyl]-4H-chromene-8-carboxylic acid::4-oxo-2-(3-(quinolin-2-ylmethoxy)phenyl)-4H-chromene-8-carboxylic acid::CHEMBL33871 Cysteinyl leukotriene receptor 1 Cavia porcellus 17 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064072 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064072&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10574284 103959172 CHEMBL33871 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056506 OC(=O)c1cc(Br)cc2c1oc(cc2=O)-c1cccc(OCc2ccc3ccccc3c2)c1 InChI=1S/C27H17BrO5/c28-20-12-22-24(29)14-25(33-26(22)23(13-20)27(30)31)19-6-3-7-21(11-19)32-15-16-8-9-17-4-1-2-5-18(17)10-16/h1-14H,15H2,(H,30,31) MDIKUXJIYAVQRI-UHFFFAOYSA-N 50064081 6-Bromo-2-[3-(naphthalen-2-ylmethoxy)-phenyl]-4-oxo-4H-chromene-8-carboxylic acid::CHEMBL34177 Cysteinyl leukotriene receptor 1 Cavia porcellus 1130 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064081 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064081&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10649085 103959181 CHEMBL34177 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056507 OC(=O)c1cccc2c1oc(cc2=O)-c1ccc(OCc2ccc3ccccc3n2)cc1 InChI=1S/C26H17NO5/c28-23-14-24(32-25-20(23)5-3-6-21(25)26(29)30)17-9-12-19(13-10-17)31-15-18-11-8-16-4-1-2-7-22(16)27-18/h1-14H,15H2,(H,29,30) CPQMZGGGIONSEK-UHFFFAOYSA-N 50064071 4-Oxo-2-[4-(quinolin-2-ylmethoxy)-phenyl]-4H-chromene-8-carboxylic acid::4-oxo-2-(4-(quinolin-2-ylmethoxy)phenyl)-4H-chromene-8-carboxylic acid::CHEMBL33294 Cysteinyl leukotriene receptor 1 Cavia porcellus 526 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064071 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064071&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 11796528 103959171 CHEMBL33294 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056508 OC(=O)c1cccc2c1oc(cc2=O)-c1ccc(OCc2ccccc2)cc1 InChI=1S/C23H16O5/c24-20-13-21(28-22-18(20)7-4-8-19(22)23(25)26)16-9-11-17(12-10-16)27-14-15-5-2-1-3-6-15/h1-13H,14H2,(H,25,26) ISVWCSWNSKOHGX-UHFFFAOYSA-N 50064065 2-(4-Benzyloxy-phenyl)-4-oxo-4H-chromene-8-carboxylic acid::CHEMBL286797 Cysteinyl leukotriene receptor 1 Cavia porcellus 55000 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064065 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064065&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10619270 103959165 CHEMBL286797 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056509 Brc1cc(C(=O)NS(=O)(=O)c2ccccc2)c2oc(cc(=O)c2c1)-c1ccc(OCc2ccc3ccccc3n2)cc1 InChI=1S/C32H21BrN2O6S/c33-22-16-26-29(36)18-30(41-31(26)27(17-22)32(37)35-42(38,39)25-7-2-1-3-8-25)21-11-14-24(15-12-21)40-19-23-13-10-20-6-4-5-9-28(20)34-23/h1-18H,19H2,(H,35,37) KYKXFOAWVGPIOD-UHFFFAOYSA-N 50064076 6-bromo-4-oxo-N-(phenylsulfonyl)-2-(4-(quinolin-2-ylmethoxy)phenyl)-4H-chromene-8-carboxamide::N-{6-Bromo-4-oxo-2-[4-(quinolin-2-ylmethoxy)-phenyl]-4H-chromene-8-carbonyl}-benzenesulfonamide::CHEMBL285994 Cysteinyl leukotriene receptor 1 Cavia porcellus 382 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064076 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064076&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10651746 103959176 CHEMBL285994 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5 50056510 O=c1cc(oc2ccc(cc12)-c1nnn[nH]1)-c1cccc(C=Cc2ccc3ccccc3n2)c1 |w:22.25| InChI=1S/C27H17N5O2/c33-24-16-26(34-25-13-10-20(15-22(24)25)27-29-31-32-30-27)19-6-3-4-17(14-19)8-11-21-12-9-18-5-1-2-7-23(18)28-21/h1-16H,(H,29,30,31,32) KSRLCKGUHAUHCH-UHFFFAOYSA-N 50064080 2-[3-((E)-2-Quinolin-2-yl-vinyl)-phenyl]-6-(1H-tetrazol-5-yl)-chromen-4-one::CHEMBL33607 Cysteinyl leukotriene receptor 1 Cavia porcellus 307 ChEMBL 10.1021/jm970179x 10.7270/Q21835MZ 9554876 Zwaagstra, ME; Timmerman, H; van de Stolpe, AC; de Kanter, FJ; Tamura, M; Wada, Y; Zhang, MQ 5/21/1998 11/10/2009 Vrije Universiteit http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50064080 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000707&target=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50064080&enzyme=Cysteinyl+leukotriene+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15485486 103959180 CHEMBL33607 1 MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE Cysteinyl leukotriene receptor 1 CLTR1_CAVPO Q2NNR5