BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50050479 OC(=O)Cn1c(O)c(O)n(Cc2cccc(c2)[N+]([O-])=O)c1=O InChI=1S/C12H11N3O7/c16-9(17)6-14-11(19)10(18)13(12(14)20)5-7-2-1-3-8(4-7)15(21)22/h1-4,18-19H,5-6H2,(H,16,17) BGDNVNUTHGLNRS-UHFFFAOYSA-N 50056528 CHEMBL160151::CHEMBL351564::[4-Hydroxy-3-(3-nitro-benzyl)-2,5-dioxo-imidazolidin-1-yl]-acetic acid Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056528 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056528&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 53680308 103952766 CHEMBL351564CHEMBL160151 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094194 OC(=O)CN1C(=O)N(Cc2cccc(c2)[N+]([O-])=O)C(=C)C1=O InChI=1S/C13H11N3O6/c1-8-12(19)15(7-11(17)18)13(20)14(8)6-9-3-2-4-10(5-9)16(21)22/h2-5H,1,6-7H2,(H,17,18) BEVCFRPRMCYQIE-UHFFFAOYSA-N 50056525 [4-Methylene-3-(3-nitro-benzyl)-2,5-dioxo-imidazolidin-1-yl]-acetic acid::CHEMBL433898 Aldo-keto reductase family 1 member B1 Rattus norvegicus 32 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056525 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056525&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10494769 103952763 CHEMBL433898 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094195 OC(=O)Cn1ccc(=O)n(Cc2cccc(c2)[N+]([O-])=O)c1=O InChI=1S/C13H11N3O6/c17-11-4-5-14(8-12(18)19)13(20)15(11)7-9-2-1-3-10(6-9)16(21)22/h1-6H,7-8H2,(H,18,19) HXPSFLFBTMZTJA-UHFFFAOYSA-N 50056526 [3-(3-Nitro-benzyl)-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl]-acetic acid::CHEMBL160032 Aldo-keto reductase family 1 member B1 Rattus norvegicus 34.0 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056526 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056526&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10685984 103952764 CHEMBL160032 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094196 c1cc(c(cc1CN2C(=O)C=CN(C2=O)CC(=O)O)[N+](=O)[O-])Cl InChI=1S/C13H10ClN3O6/c14-9-2-1-8(5-10(9)17(22)23)6-16-11(18)3-4-15(13(16)21)7-12(19)20/h1-5H,6-7H2,(H,19,20) SRSCMKAWNIMFBH-UHFFFAOYSA-N 50056527 [3-(4-Chloro-3-nitro-benzyl)-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl]-acetic acid::CHEMBL161556 Aldo-keto reductase family 1 member B1 Rattus norvegicus 25.0 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056527 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056527&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 48I 4XZH 10759546 103952765 CHEMBL161556 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094198 OC(=O)Cn1cc(O)n(Cc2cccc(c2)[N+]([O-])=O)c1=O InChI=1S/C12H11N3O6/c16-10-6-13(7-11(17)18)12(19)14(10)5-8-2-1-3-9(4-8)15(20)21/h1-4,6,16H,5,7H2,(H,17,18) KVNTYWMVIFNSIP-UHFFFAOYSA-N 50056529 [3-(3-Nitro-benzyl)-2,4-dioxo-imidazolidin-1-yl]-acetic acid::CHEMBL159877 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056529 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056529&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 54015807 103952767 CHEMBL159877 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094199 OC(=O)Cn1c(=O)ccn(Cc2cccc(c2)[N+]([O-])=O)c1=O InChI=1S/C13H11N3O6/c17-11-4-5-14(13(20)15(11)8-12(18)19)7-9-2-1-3-10(6-9)16(21)22/h1-6H,7-8H2,(H,18,19) SJVJLGNXBBJBOL-UHFFFAOYSA-N 50056530 [3-(3-Nitro-benzyl)-2,6-dioxo-3,6-dihydro-2H-pyrimidin-1-yl]-acetic acid::CHEMBL161235 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056530 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056530&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 10804501 103952768 CHEMBL161235 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094200 OC(=O)CN1C(=O)N(Cc2nc3c(Cl)cccc3s2)C(=O)C1=O InChI=1S/C13H8ClN3O5S/c14-6-2-1-3-7-10(6)15-8(23-7)4-16-11(20)12(21)17(13(16)22)5-9(18)19/h1-3H,4-5H2,(H,18,19) ZTHVOUBQLKCDHN-UHFFFAOYSA-N 50056531 [3-(4-Chloro-benzothiazol-2-ylmethyl)-2,4,5-trioxo-imidazolidin-1-yl]-acetic acid::CHEMBL161043 Aldo-keto reductase family 1 member B1 Rattus norvegicus 12 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056531 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056531&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 9884914 103952769 CHEMBL161043 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094201 c1cc(c(cc1CN2C(=O)C=CN(C2=O)CC(=O)O)[N+](=O)[O-])Cl InChI=1S/C13H10ClN3O6/c14-9-2-1-8(5-10(9)17(22)23)6-16-11(18)3-4-15(13(16)21)7-12(19)20/h1-5H,6-7H2,(H,19,20) SRSCMKAWNIMFBH-UHFFFAOYSA-N 50056527 [3-(4-Chloro-3-nitro-benzyl)-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl]-acetic acid::CHEMBL161556 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056527 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056527&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 48I 4XZH 10759546 103952765 CHEMBL161556 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094202 OC(=O)CN1C(=O)N(Cc2cccc(c2)[N+]([O-])=O)C(=C)C1=O InChI=1S/C13H11N3O6/c1-8-12(19)15(7-11(17)18)13(20)14(8)6-9-3-2-4-10(5-9)16(21)22/h2-5H,1,6-7H2,(H,17,18) BEVCFRPRMCYQIE-UHFFFAOYSA-N 50056525 [4-Methylene-3-(3-nitro-benzyl)-2,5-dioxo-imidazolidin-1-yl]-acetic acid::CHEMBL433898 Aldo-keto reductase family 1 member A1 Rattus norvegicus 58000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056525 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056525&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 10494769 103952763 CHEMBL433898 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094203 OC(=O)CN1C(=S)N(Cc2cccc(c2)[N+]([O-])=O)C(=O)C1=O InChI=1S/C12H9N3O6S/c16-9(17)6-14-11(19)10(18)13(12(14)22)5-7-2-1-3-8(4-7)15(20)21/h1-4H,5-6H2,(H,16,17) NTWQJLVMCMGYFX-UHFFFAOYSA-N 50056532 [3-(3-Nitro-benzyl)-4,5-dioxo-2-thioxo-imidazolidin-1-yl]-acetic acid::CHEMBL434076 Aldo-keto reductase family 1 member A1 Rattus norvegicus 28000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056532 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056532&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 10639626 103952770 CHEMBL434076 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094204 OC(=O)CN1C(=S)N(Cc2cccc(c2)[N+]([O-])=O)C(=O)C1=O InChI=1S/C12H9N3O6S/c16-9(17)6-14-11(19)10(18)13(12(14)22)5-7-2-1-3-8(4-7)15(20)21/h1-4H,5-6H2,(H,16,17) NTWQJLVMCMGYFX-UHFFFAOYSA-N 50056532 [3-(3-Nitro-benzyl)-4,5-dioxo-2-thioxo-imidazolidin-1-yl]-acetic acid::CHEMBL434076 Aldo-keto reductase family 1 member B1 Rattus norvegicus 25.0 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056532 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056532&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10639626 103952770 CHEMBL434076 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094205 OC(=O)CN1C(=O)N(Cc2cccc(c2)[N+]([O-])=O)C(=O)C1=O InChI=1S/C12H9N3O7/c16-9(17)6-14-11(19)10(18)13(12(14)20)5-7-2-1-3-8(4-7)15(21)22/h1-4H,5-6H2,(H,16,17) YREIRIKJAMPPHC-UHFFFAOYSA-N 50049729 [3-(3-Nitro-benzyl)-2,4,5-trioxo-imidazolidin-1-yl]-acetic acid::CHEMBL292887 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50049729 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50049729&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 9926581 103980040 CHEMBL292887 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094206 OC(=O)Cn1ccc(=O)n(Cc2nc3c(Cl)cccc3s2)c1=O InChI=1S/C14H10ClN3O4S/c15-8-2-1-3-9-13(8)16-10(23-9)6-18-11(19)4-5-17(14(18)22)7-12(20)21/h1-5H,6-7H2,(H,20,21) AJPDCVIUHLYGIP-UHFFFAOYSA-N 50056534 [3-(4-Chloro-benzothiazol-2-ylmethyl)-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl]-acetic acid::CHEMBL162697 Aldo-keto reductase family 1 member B1 Rattus norvegicus 11 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056534 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056534&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10089322 103952772 CHEMBL162697 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094207 OC(=O)CN1C(=O)N(Cc2nc3c(Cl)cccc3s2)C(=O)C1=O InChI=1S/C13H8ClN3O5S/c14-6-2-1-3-7-10(6)15-8(23-7)4-16-11(20)12(21)17(13(16)22)5-9(18)19/h1-3H,4-5H2,(H,18,19) ZTHVOUBQLKCDHN-UHFFFAOYSA-N 50056531 [3-(4-Chloro-benzothiazol-2-ylmethyl)-2,4,5-trioxo-imidazolidin-1-yl]-acetic acid::CHEMBL161043 Aldo-keto reductase family 1 member A1 Rattus norvegicus 72000.0 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056531 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056531&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 9884914 103952769 CHEMBL161043 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094208 OC(=O)Cn1cc(O)n(Cc2ccc(Cl)c(c2)[N+]([O-])=O)c1=O InChI=1S/C12H10ClN3O6/c13-8-2-1-7(3-9(8)16(21)22)4-15-10(17)5-14(12(15)20)6-11(18)19/h1-3,5,17H,4,6H2,(H,18,19) YWHKHARYPFDPOR-UHFFFAOYSA-N 50056533 [3-(4-Chloro-3-nitro-benzyl)-2,4-dioxo-imidazolidin-1-yl]-acetic acid::CHEMBL349508 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056533 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056533&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 54530668 103952771 CHEMBL349508 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094209 OC(=O)Cn1c(O)cn(Cc2cccc(c2)[N+]([O-])=O)c1=O InChI=1S/C12H11N3O6/c16-10-6-13(12(19)14(10)7-11(17)18)5-8-2-1-3-9(4-8)15(20)21/h1-4,6,16H,5,7H2,(H,17,18) FWRVDWSUBDQMQA-UHFFFAOYSA-N 50056536 [3-(3-Nitro-benzyl)-2,5-dioxo-imidazolidin-1-yl]-acetic acid::CHEMBL159750 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056536 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056536&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 53822415 103952774 CHEMBL159750 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094210 OC(=O)Cn1c(=O)cc(O)n(Cc2cccc(c2)[N+]([O-])=O)c1=O InChI=1S/C13H11N3O7/c17-10-5-11(18)15(7-12(19)20)13(21)14(10)6-8-2-1-3-9(4-8)16(22)23/h1-5,17H,6-7H2,(H,19,20) FHNOCJKWYJJEJT-UHFFFAOYSA-N 50056537 [3-(3-Nitro-benzyl)-2,4,6-trioxo-tetrahydro-pyrimidin-1-yl]-acetic acid::CHEMBL159475 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056537 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056537&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 91929499 103952775 CHEMBL159475 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094211 OC(=O)CN1C(=O)N(Cc2ccc(Cl)c(c2)[N+]([O-])=O)C(=O)C1=O InChI=1S/C12H8ClN3O7/c13-7-2-1-6(3-8(7)16(22)23)4-14-10(19)11(20)15(12(14)21)5-9(17)18/h1-3H,4-5H2,(H,17,18) OKAMCOXTUSQTGW-UHFFFAOYSA-N 50056535 [3-(4-Chloro-3-nitro-benzyl)-2,4,5-trioxo-imidazolidin-1-yl]-acetic acid::CHEMBL355148 Aldo-keto reductase family 1 member B1 Rattus norvegicus 16 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056535 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056535&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10807201 103952773 CHEMBL355148 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094212 C\C(\C=C1/SC(=S)N(CC(O)=O)C1=O)=C/c1ccccc1 InChI=1S/C15H13NO3S2/c1-10(7-11-5-3-2-4-6-11)8-12-14(19)16(9-13(17)18)15(20)21-12/h2-8H,9H2,1H3,(H,17,18) CHNUOJQWGUIOLD-UHFFFAOYSA-N 50049730 Epalrestat::2-(5-(2-methyl-3-phenylallylidene)-4-oxo-2-thioxothiazolidin-3-yl)acetic acid::{5-[(E)-2-Methyl-3-phenyl-prop-2-en-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-acetic acid::CHEMBL56337 Aldo-keto reductase family 1 member B1 Rattus norvegicus 21 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50049730 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50049730&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 1549120 103980041 CHEMBL56337 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094213 OC(=O)Cn1ccc(=O)n(Cc2cccc(c2)[N+]([O-])=O)c1=O InChI=1S/C13H11N3O6/c17-11-4-5-14(8-12(18)19)13(20)15(11)7-9-2-1-3-10(6-9)16(21)22/h1-6H,7-8H2,(H,18,19) HXPSFLFBTMZTJA-UHFFFAOYSA-N 50056526 [3-(3-Nitro-benzyl)-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl]-acetic acid::CHEMBL160032 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056526 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056526&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 10685984 103952764 CHEMBL160032 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094214 c1cc2c(cc1Cl)nc(s2)CN3C(=O)C=CN(C3=O)CC(=O)O InChI=1S/C14H10ClN3O4S/c15-8-1-2-10-9(5-8)16-11(23-10)6-18-12(19)3-4-17(14(18)22)7-13(20)21/h1-5H,6-7H2,(H,20,21) RQWICELTTDJODO-UHFFFAOYSA-N 50056538 {3-[(5-CHLORO-1,3-BENZOTHIAZOL-2-YL)METHYL]-2,4-DIOXO-3,4-DIHYDROPYRIMIDIN-1(2H)-YL}ACETIC ACID::[3-(5-Chloro-benzothiazol-2-ylmethyl)-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl]-acetic acid::CHEMBL159820 Aldo-keto reductase family 1 member B1 Rattus norvegicus 5.7 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056538 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056538&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 47D 2PDG,2PDH,2PDN,2PDQ 10450624 103952776 CHEMBL159820 DB07093 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094215 OC(=O)CN1C(=O)N(Cc2nc3cc(Cl)ccc3s2)C(=O)C1=O InChI=1S/C13H8ClN3O5S/c14-6-1-2-8-7(3-6)15-9(23-8)4-16-11(20)12(21)17(13(16)22)5-10(18)19/h1-3H,4-5H2,(H,18,19) GHYVVUAWEAOHGR-UHFFFAOYSA-N 50056540 [3-(5-Chloro-benzothiazol-2-ylmethyl)-2,4,5-trioxo-imidazolidin-1-yl]-acetic acid::CHEMBL159413 Aldo-keto reductase family 1 member B1 Rattus norvegicus 15 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056540 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056540&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 10570082 103952778 CHEMBL159413 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094216 C\C(\C=C1/SC(=S)N(CC(O)=O)C1=O)=C/c1ccccc1 InChI=1S/C15H13NO3S2/c1-10(7-11-5-3-2-4-6-11)8-12-14(19)16(9-13(17)18)15(20)21-12/h2-8H,9H2,1H3,(H,17,18) CHNUOJQWGUIOLD-UHFFFAOYSA-N 50049730 Epalrestat::2-(5-(2-methyl-3-phenylallylidene)-4-oxo-2-thioxothiazolidin-3-yl)acetic acid::{5-[(E)-2-Methyl-3-phenyl-prop-2-en-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-acetic acid::CHEMBL56337 Aldo-keto reductase family 1 member A1 Rattus norvegicus 1500 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50049730 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50049730&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 1549120 103980041 CHEMBL56337 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094217 OC(=O)CN1C(=C)N(Cc2cccc(c2)[N+]([O-])=O)C(=O)C1=O InChI=1S/C13H11N3O6/c1-8-14(12(19)13(20)15(8)7-11(17)18)6-9-3-2-4-10(5-9)16(21)22/h2-5H,1,6-7H2,(H,17,18) SJCNQTFUQFAZLN-UHFFFAOYSA-N 50056541 [2-Methylene-3-(3-nitro-benzyl)-4,5-dioxo-imidazolidin-1-yl]-acetic acid::CHEMBL159288 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056541 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056541&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 10638264 103952779 CHEMBL159288 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094218 OC(=O)Cn1cc(O)n(Cc2nc3c(Cl)cccc3s2)c1=O InChI=1S/C13H10ClN3O4S/c14-7-2-1-3-8-12(7)15-9(22-8)4-17-10(18)5-16(13(17)21)6-11(19)20/h1-3,5,18H,4,6H2,(H,19,20) WKJVVLRBKXSPPP-UHFFFAOYSA-N 50056539 [3-(4-Chloro-benzothiazol-2-ylmethyl)-2,4-dioxo-imidazolidin-1-yl]-acetic acid::CHEMBL159384 Aldo-keto reductase family 1 member B1 Rattus norvegicus 62 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056539 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056539&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 54435440 103952777 CHEMBL159384 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094219 c1cc2c(cc1Cl)nc(s2)CN3C(=O)C=CN(C3=O)CC(=O)O InChI=1S/C14H10ClN3O4S/c15-8-1-2-10-9(5-8)16-11(23-10)6-18-12(19)3-4-17(14(18)22)7-13(20)21/h1-5H,6-7H2,(H,20,21) RQWICELTTDJODO-UHFFFAOYSA-N 50056538 {3-[(5-CHLORO-1,3-BENZOTHIAZOL-2-YL)METHYL]-2,4-DIOXO-3,4-DIHYDROPYRIMIDIN-1(2H)-YL}ACETIC ACID::[3-(5-Chloro-benzothiazol-2-ylmethyl)-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl]-acetic acid::CHEMBL159820 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056538 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056538&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 47D 2PDG,2PDH,2PDN,2PDQ 10450624 103952776 CHEMBL159820 DB07093 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094220 OC(=O)Cn1cc(O)n(Cc2nc3c(Cl)cccc3s2)c1=O InChI=1S/C13H10ClN3O4S/c14-7-2-1-3-8-12(7)15-9(22-8)4-17-10(18)5-16(13(17)21)6-11(19)20/h1-3,5,18H,4,6H2,(H,19,20) WKJVVLRBKXSPPP-UHFFFAOYSA-N 50056539 [3-(4-Chloro-benzothiazol-2-ylmethyl)-2,4-dioxo-imidazolidin-1-yl]-acetic acid::CHEMBL159384 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056539 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056539&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 54435440 103952777 CHEMBL159384 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094221 OC(=O)CN1C(=O)N(Cc2cccc(c2)[N+]([O-])=O)C(=O)C1=O InChI=1S/C12H9N3O7/c16-9(17)6-14-11(19)10(18)13(12(14)20)5-7-2-1-3-8(4-7)15(21)22/h1-4H,5-6H2,(H,16,17) YREIRIKJAMPPHC-UHFFFAOYSA-N 50049729 [3-(3-Nitro-benzyl)-2,4,5-trioxo-imidazolidin-1-yl]-acetic acid::CHEMBL292887 Aldo-keto reductase family 1 member B1 Rattus norvegicus 62 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50049729 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50049729&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 9926581 103980040 CHEMBL292887 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094222 OC(=O)CN1C(=O)N(Cc2ccc(Cl)c(c2)[N+]([O-])=O)C(=O)C1=O InChI=1S/C12H8ClN3O7/c13-7-2-1-6(3-8(7)16(22)23)4-14-10(19)11(20)15(12(14)21)5-9(17)18/h1-3H,4-5H2,(H,17,18) OKAMCOXTUSQTGW-UHFFFAOYSA-N 50056535 [3-(4-Chloro-3-nitro-benzyl)-2,4,5-trioxo-imidazolidin-1-yl]-acetic acid::CHEMBL355148 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056535 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056535&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 10807201 103952773 CHEMBL355148 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094223 OC(=O)Cn1c(O)c(O)n(Cc2cccc(c2)[N+]([O-])=O)c1=O InChI=1S/C12H11N3O7/c16-9(17)6-14-11(19)10(18)13(12(14)20)5-7-2-1-3-8(4-7)15(21)22/h1-4,18-19H,5-6H2,(H,16,17) BGDNVNUTHGLNRS-UHFFFAOYSA-N 50056528 CHEMBL160151::CHEMBL351564::[4-Hydroxy-3-(3-nitro-benzyl)-2,5-dioxo-imidazolidin-1-yl]-acetic acid Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056528 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056528&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 53680308 103952766 CHEMBL351564CHEMBL160151 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094224 OC(=O)Cn1cc(O)n(Cc2ccc(Cl)c(c2)[N+]([O-])=O)c1=O InChI=1S/C12H10ClN3O6/c13-8-2-1-7(3-9(8)16(21)22)4-15-10(17)5-14(12(15)20)6-11(18)19/h1-3,5,17H,4,6H2,(H,18,19) YWHKHARYPFDPOR-UHFFFAOYSA-N 50056533 [3-(4-Chloro-3-nitro-benzyl)-2,4-dioxo-imidazolidin-1-yl]-acetic acid::CHEMBL349508 Aldo-keto reductase family 1 member B1 Rattus norvegicus 24 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056533 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002198&target=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056533&enzyme=Aldo-keto+reductase+family+1+member+B1&column=ki&startPg=0&Increment=50&submit=Search 54530668 103952771 CHEMBL349508 1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV Aldo-keto reductase family 1 member B1 ALDR_RAT P07943 50094225 OC(=O)CN1C(=O)N(Cc2nc3cc(Cl)ccc3s2)C(=O)C1=O InChI=1S/C13H8ClN3O5S/c14-6-1-2-8-7(3-6)15-9(23-8)4-16-11(20)12(21)17(13(16)22)5-10(18)19/h1-3H,4-5H2,(H,18,19) GHYVVUAWEAOHGR-UHFFFAOYSA-N 50056540 [3-(5-Chloro-benzothiazol-2-ylmethyl)-2,4,5-trioxo-imidazolidin-1-yl]-acetic acid::CHEMBL159413 Aldo-keto reductase family 1 member A1 Rattus norvegicus 58000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056540 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056540&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 10570082 103952778 CHEMBL159413 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635 50094226 OC(=O)Cn1ccc(=O)n(Cc2nc3c(Cl)cccc3s2)c1=O InChI=1S/C14H10ClN3O4S/c15-8-2-1-3-9-13(8)16-10(23-9)6-18-11(19)4-5-17(14(18)22)7-12(20)21/h1-5H,6-7H2,(H,20,21) AJPDCVIUHLYGIP-UHFFFAOYSA-N 50056534 [3-(4-Chloro-benzothiazol-2-ylmethyl)-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl]-acetic acid::CHEMBL162697 Aldo-keto reductase family 1 member A1 Rattus norvegicus >100000 ChEMBL 10.1021/jm960594+ 10.7270/Q2251H84 9057855 Kotani, T; Nagaki, Y; Ishii, A; Konishi, Y; Yago, H; Suehiro, S; Okukado, N; Okamoto, K 4/17/1997 11/10/2009 Nippon Zoki Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056534 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001907&target=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056534&enzyme=Aldo-keto+reductase+family+1+member+A1&column=ki&startPg=0&Increment=50&submit=Search 10089322 103952772 CHEMBL162697 1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY Aldo-keto reductase family 1 member A1 AK1A1_RAT P51635