BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50044099 CCCCCCCCCCCCCSc1nnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)[nH]1 InChI=1S/C28H47N5OS/c1-6-7-8-9-10-11-12-13-14-15-16-20-35-28-31-26(32-33-28)30-27(34)29-25-23(21(2)3)18-17-19-24(25)22(4)5/h17-19,21-22H,6-16,20H2,1-5H3,(H3,29,30,31,32,33,34) XMOXRGHOOOIJLC-UHFFFAOYSA-N 50054276 1-(2,6-Diisopropyl-phenyl)-3-(5-tridecylsulfanyl-4H-[1,2,4]triazol-3-yl)-urea::CHEMBL422452 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 390 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054276 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054276&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10505605 103950926 CHEMBL422452 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044100 CCCCCCCCCCCCCS(=O)c1nnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)[nH]1 InChI=1S/C28H47N5O2S/c1-6-7-8-9-10-11-12-13-14-15-16-20-36(35)28-31-26(32-33-28)30-27(34)29-25-23(21(2)3)18-17-19-24(25)22(4)5/h17-19,21-22H,6-16,20H2,1-5H3,(H3,29,30,31,32,33,34) LLAOUPGRBAILMD-UHFFFAOYSA-N 50054274 1-(2,6-Diisopropyl-phenyl)-3-[5-(tridecane-1-sulfinyl)-4H-[1,2,4]triazol-3-yl]-urea::CHEMBL134366 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 1700 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054274 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054274&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10625730 103950924 CHEMBL134366 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044101 CCCCCCCCCCCc1csc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)n1 InChI=1S/C27H43N3OS/c1-6-7-8-9-10-11-12-13-14-16-22-19-32-27(28-22)30-26(31)29-25-23(20(2)3)17-15-18-24(25)21(4)5/h15,17-21H,6-14,16H2,1-5H3,(H2,28,29,30,31) NDOYGWQZBSVXBB-UHFFFAOYSA-N 50054282 1-(2,6-Diisopropyl-phenyl)-3-(4-undecyl-thiazol-2-yl)-urea::CHEMBL137693 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 150 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054282 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054282&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10527844 103950932 CHEMBL137693 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044102 CCCCCCCCCCCCc1coc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)n1 InChI=1S/C28H45N3O2/c1-6-7-8-9-10-11-12-13-14-15-17-23-20-33-28(29-23)31-27(32)30-26-24(21(2)3)18-16-19-25(26)22(4)5/h16,18-22H,6-15,17H2,1-5H3,(H2,29,30,31,32) QJIGNWBXZVWVLT-UHFFFAOYSA-N 50054283 1-(2,6-Diisopropyl-phenyl)-3-(4-dodecyl-oxazol-2-yl)-urea::CHEMBL342666 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 63 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054283 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054283&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10695097 103950933 CHEMBL342666 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044103 CCCCCCCCCCCCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:16| InChI=1S/C28H50N6O/c1-6-7-8-9-10-11-12-13-14-15-16-17-21-34-32-27(31-33-34)30-28(35)29-26-24(22(2)3)19-18-20-25(26)23(4)5/h18-20,22-23,33H,6-17,21H2,1-5H3,(H3,29,30,31,32,35) WCVVLTMQIQIXDW-UHFFFAOYSA-N 50054288 1-(2,6-Diisopropyl-phenyl)-3-(2-tetradecyl-2,3-dihydro-1H-tetrazol-5-yl)-urea::CHEMBL136804 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 12 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054288 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054288&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44358072 103950938 CHEMBL136804 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044104 CCCCCCCCCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:13| InChI=1S/C25H44N6O/c1-6-7-8-9-10-11-12-13-14-18-31-29-24(28-30-31)27-25(32)26-23-21(19(2)3)16-15-17-22(23)20(4)5/h15-17,19-20,30H,6-14,18H2,1-5H3,(H3,26,27,28,29,32) VKKMWXJRPJWJHM-UHFFFAOYSA-N 50054305 1-(2,6-Diisopropyl-phenyl)-3-(2-undecyl-2,3-dihydro-1H-tetrazol-5-yl)-urea::CHEMBL337336 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 9 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054305 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054305&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44357896 103950955 CHEMBL337336 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044105 COC(=O)CCCCCCCCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:16| InChI=1S/C26H44N6O3/c1-19(2)21-15-14-16-22(20(3)4)24(21)27-26(34)28-25-29-31-32(30-25)18-13-11-9-7-6-8-10-12-17-23(33)35-5/h14-16,19-20,31H,6-13,17-18H2,1-5H3,(H3,27,28,29,30,34) XZDZHWHPWMPZIS-UHFFFAOYSA-N 50054280 11-{5-[3-(2,6-Diisopropyl-phenyl)-ureido]-1,3-dihydro-tetrazol-2-yl}-undecanoic acid methyl ester::CHEMBL136802 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 4700 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054280 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054280&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44358071 103950930 CHEMBL136802 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044106 CCCCCCCCCCCCCSc1nnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)n1C(C)=O InChI=1S/C30H49N5O2S/c1-7-8-9-10-11-12-13-14-15-16-17-21-38-30-34-33-28(35(30)24(6)36)32-29(37)31-27-25(22(2)3)19-18-20-26(27)23(4)5/h18-20,22-23H,7-17,21H2,1-6H3,(H2,31,32,33,37) SCZADDSZHZAKHC-UHFFFAOYSA-N 50054311 1-(4-Acetyl-5-tridecylsulfanyl-4H-[1,2,4]triazol-3-yl)-3-(2,6-diisopropyl-phenyl)-urea::CHEMBL136626 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 680 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054311 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054311&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10626346 103950961 CHEMBL136626 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044107 CCCCCCCCCCCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:15| InChI=1S/C27H48N6O/c1-6-7-8-9-10-11-12-13-14-15-16-20-33-31-26(30-32-33)29-27(34)28-25-23(21(2)3)18-17-19-24(25)22(4)5/h17-19,21-22,32H,6-16,20H2,1-5H3,(H3,28,29,30,31,34) PHMCNJPSRGAXPU-UHFFFAOYSA-N 50054300 1-(2,6-Diisopropyl-phenyl)-3-(2-tridecyl-2,3-dihydro-1H-tetrazol-5-yl)-urea::CHEMBL336445 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 9 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054300 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054300&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44358145 103950950 CHEMBL336445 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044108 CCCCCCCCCCCCCc1cc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)no1 InChI=1S/C29H47N3O2/c1-6-7-8-9-10-11-12-13-14-15-16-18-24-21-27(32-34-24)30-29(33)31-28-25(22(2)3)19-17-20-26(28)23(4)5/h17,19-23H,6-16,18H2,1-5H3,(H2,30,31,32,33) RVCXSEPZHZNOAW-UHFFFAOYSA-N 50054278 1-(2,6-Diisopropyl-phenyl)-3-(5-tridecyl-isoxazol-3-yl)-urea::CHEMBL138886 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 14 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054278 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054278&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10742963 103950928 CHEMBL138886 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044109 CCCCCCCCCCc1sc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)nc1C InChI=1S/C27H43N3OS/c1-7-8-9-10-11-12-13-14-18-24-21(6)28-27(32-24)30-26(31)29-25-22(19(2)3)16-15-17-23(25)20(4)5/h15-17,19-20H,7-14,18H2,1-6H3,(H2,28,29,30,31) XUVOPVWSIKAVME-UHFFFAOYSA-N 50054292 1-(5-Decyl-4-methyl-thiazol-2-yl)-3-(2,6-diisopropyl-phenyl)-urea::CHEMBL136500 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 120 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054292 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054292&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 9846939 103950942 CHEMBL136500 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044110 [#6]-[#6](-[#6])-c1cccc(-[#6](-[#6])-[#6])c1-[#7]-[#6](=O)-[#7]-[#6]-1=[#7]-[#7](-[#6]-[#6]\[#6]=[#6](/[#6])-[#6]-[#6]\[#6]=[#6](\[#6])-[#6])-[#7]-[#7]-1 |t:17| InChI=1S/C25H3N6O/c1-17(2)11-8-12-20(7)13-10-16-31-29-24(28-30-31)27-25(32)26-23-21(18(3)4)14-9-15-22(23)19(5)6/h9,14-15H IKYVCPTXLJWZIC-UHFFFAOYSA-N 50054310 1-(2,6-Diisopropyl-phenyl)-3-[2-((E)-4,8-dimethyl-nona-3,7-dienyl)-2,3-dihydro-1H-tetrazol-5-yl]-urea::CHEMBL136662 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 63 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054310 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054310&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44358117 103950960 CHEMBL136662 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044111 CCCCCCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:10| InChI=1S/C22H38N6O/c1-6-7-8-9-10-11-15-28-26-21(25-27-28)24-22(29)23-20-18(16(2)3)13-12-14-19(20)17(4)5/h12-14,16-17,27H,6-11,15H2,1-5H3,(H3,23,24,25,26,29) JADJVFAPYMGNDE-UHFFFAOYSA-N 50054273 1-(2,6-Diisopropyl-phenyl)-3-(2-octyl-2,3-dihydro-1H-tetrazol-5-yl)-urea::CHEMBL344628 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 59 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054273 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054273&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44358118 103950923 CHEMBL344628 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044112 CCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:6| InChI=1S/C18H30N6O/c1-6-7-11-24-22-17(21-23-24)20-18(25)19-16-14(12(2)3)9-8-10-15(16)13(4)5/h8-10,12-13,23H,6-7,11H2,1-5H3,(H3,19,20,21,22,25) KENWCOMAIBSJBT-UHFFFAOYSA-N 50054303 1-(2-Butyl-2,3-dihydro-1H-tetrazol-5-yl)-3-(2,6-diisopropyl-phenyl)-urea::CHEMBL442409 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 92 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054303 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054303&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44358201 103950953 CHEMBL442409 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044113 CCCCCCCCCCCCCCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:18| InChI=1S/C30H54N6O/c1-6-7-8-9-10-11-12-13-14-15-16-17-18-19-23-36-34-29(33-35-36)32-30(37)31-28-26(24(2)3)21-20-22-27(28)25(4)5/h20-22,24-25,35H,6-19,23H2,1-5H3,(H3,31,32,33,34,37) PZBMJRGRCLUCPW-UHFFFAOYSA-N 50054290 1-(2,6-Diisopropyl-phenyl)-3-(2-hexadecyl-2,3-dihydro-1H-tetrazol-5-yl)-urea::CHEMBL342427 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 57 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054290 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054290&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44357906 103950940 CHEMBL342427 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044114 CCCCCCCCCCCCn1ncnc1NC(=O)Nc1c(cccc1C(C)C)C(C)C InChI=1S/C27H45N5O/c1-6-7-8-9-10-11-12-13-14-15-19-32-26(28-20-29-32)31-27(33)30-25-23(21(2)3)17-16-18-24(25)22(4)5/h16-18,20-22H,6-15,19H2,1-5H3,(H2,28,29,30,31,33) PFDJLKXJMXYXBY-UHFFFAOYSA-N 50054307 1-(2,6-Diisopropyl-phenyl)-3-(2-dodecyl-2H-[1,2,4]triazol-3-yl)-urea::CHEMBL136306 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 250 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054307 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054307&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10527767 103950957 CHEMBL136306 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044116 CC(C)c1cccc(C(C)C)c1NC(=O)NC1=NN(CCCCCCCCCCCO)NN1 |t:17| InChI=1S/C25H44N6O2/c1-19(2)21-15-14-16-22(20(3)4)23(21)26-25(33)27-24-28-30-31(29-24)17-12-10-8-6-5-7-9-11-13-18-32/h14-16,19-20,30,32H,5-13,17-18H2,1-4H3,(H3,26,27,28,29,33) WEQCCIXAGBVGQJ-UHFFFAOYSA-N 50054308 1-(2,6-Diisopropyl-phenyl)-3-[2-(11-hydroxy-undecyl)-2,3-dihydro-1H-tetrazol-5-yl]-urea::CHEMBL337811 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 32 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054308 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054308&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44357924 103950958 CHEMBL337811 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044117 CCCCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:8| InChI=1S/C20H34N6O/c1-6-7-8-9-13-26-24-19(23-25-26)22-20(27)21-18-16(14(2)3)11-10-12-17(18)15(4)5/h10-12,14-15,25H,6-9,13H2,1-5H3,(H3,21,22,23,24,27) OTJKMNZIGFIRST-UHFFFAOYSA-N 50054306 1-(2,6-Diisopropyl-phenyl)-3-(2-hexyl-2,3-dihydro-1H-tetrazol-5-yl)-urea::CHEMBL138070 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 73 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054306 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054306&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44358109 103950956 CHEMBL138070 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044118 CCCCCCCCCCCCn1cnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)n1 InChI=1S/C27H45N5O/c1-6-7-8-9-10-11-12-13-14-15-19-32-20-28-26(31-32)30-27(33)29-25-23(21(2)3)17-16-18-24(25)22(4)5/h16-18,20-22H,6-15,19H2,1-5H3,(H2,29,30,31,33) CACGIEHSSQYSOW-UHFFFAOYSA-N 50054285 1-(2,6-Diisopropyl-phenyl)-3-(1-dodecyl-1H-[1,2,4]triazol-3-yl)-urea::CHEMBL134632 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 120 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054285 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054285&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10647438 103950935 CHEMBL134632 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044119 CCCCCCCCCCn1nnnc1NC(=O)Nc1c(cccc1C(C)C)C(C)C InChI=1S/C24H40N6O/c1-6-7-8-9-10-11-12-13-17-30-23(27-28-29-30)26-24(31)25-22-20(18(2)3)15-14-16-21(22)19(4)5/h14-16,18-19H,6-13,17H2,1-5H3,(H2,25,26,27,29,31) JNODAZZPTHXTDT-UHFFFAOYSA-N 50054295 1-(1-Decyl-1H-tetrazol-5-yl)-3-(2,6-diisopropyl-phenyl)-urea::CHEMBL138911 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 180 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054295 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054295&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10693847 103950945 CHEMBL138911 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044120 CCCCCCCCCCCCCc1nnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)s1 InChI=1S/C28H46N4OS/c1-6-7-8-9-10-11-12-13-14-15-16-20-25-31-32-28(34-25)30-27(33)29-26-23(21(2)3)18-17-19-24(26)22(4)5/h17-19,21-22H,6-16,20H2,1-5H3,(H2,29,30,32,33) UFGIXSFXEUEZPS-UHFFFAOYSA-N 50054298 1-(2,6-Diisopropyl-phenyl)-3-(5-tridecyl-[1,3,4]thiadiazol-2-yl)-urea::CHEMBL136257 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 36 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054298 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054298&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10576915 103950948 CHEMBL136257 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044121 CCCCCCCCCCCCn1cnnc1NC(=O)Nc1c(cccc1C(C)C)C(C)C InChI=1S/C27H45N5O/c1-6-7-8-9-10-11-12-13-14-15-19-32-20-28-31-26(32)30-27(33)29-25-23(21(2)3)17-16-18-24(25)22(4)5/h16-18,20-22H,6-15,19H2,1-5H3,(H2,29,30,31,33) ADIINPQXGUOOJD-UHFFFAOYSA-N 50054299 1-(2,6-Diisopropyl-phenyl)-3-(4-dodecyl-4H-[1,2,4]triazol-3-yl)-urea::CHEMBL139263 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 1500 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054299 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054299&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10647439 103950949 CHEMBL139263 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044122 CC(C)c1cccc(C(C)C)c1NC(=O)NC1=NN(Cc2ccccc2)NN1 |t:17| InChI=1S/C21H28N6O/c1-14(2)17-11-8-12-18(15(3)4)19(17)22-21(28)23-20-24-26-27(25-20)13-16-9-6-5-7-10-16/h5-12,14-15,26H,13H2,1-4H3,(H3,22,23,24,25,28) VHVCQYVHYOHIPM-UHFFFAOYSA-N 50054275 1-(2-Benzyl-2,3-dihydro-1H-tetrazol-5-yl)-3-(2,6-diisopropyl-phenyl)-urea::CHEMBL134794 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 370 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054275 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054275&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44358202 103950925 CHEMBL134794 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044123 CCCCCCCCCCCCc1cc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)on1 InChI=1S/C28H45N3O2/c1-6-7-8-9-10-11-12-13-14-15-17-23-20-26(33-31-23)29-28(32)30-27-24(21(2)3)18-16-19-25(27)22(4)5/h16,18-22H,6-15,17H2,1-5H3,(H2,29,30,32) CYWOEDOCMPEDFM-UHFFFAOYSA-N 50054294 1-(2,6-Diisopropyl-phenyl)-3-(3-dodecyl-isoxazol-5-yl)-urea::CHEMBL136631 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 19 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054294 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054294&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10004175 103950944 CHEMBL136631 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044124 CCCCCCCCCCCCn1cnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)c1 InChI=1S/C28H46N4O/c1-6-7-8-9-10-11-12-13-14-15-19-32-20-26(29-21-32)30-28(33)31-27-24(22(2)3)17-16-18-25(27)23(4)5/h16-18,20-23H,6-15,19H2,1-5H3,(H2,30,31,33) PGOQMVRMMUVLON-UHFFFAOYSA-N 50054289 1-(2,6-Diisopropyl-phenyl)-3-(1-dodecyl-1H-imidazol-4-yl)-urea::CHEMBL139039 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 35 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054289 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054289&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10575716 103950939 CHEMBL139039 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044125 CCCCCCCCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:12| InChI=1S/C24H42N6O/c1-6-7-8-9-10-11-12-13-17-30-28-23(27-29-30)26-24(31)25-22-20(18(2)3)15-14-16-21(22)19(4)5/h14-16,18-19,29H,6-13,17H2,1-5H3,(H3,25,26,27,28,31) DXTBBPXFVSTLGE-UHFFFAOYSA-N 50054284 1-(2-Decyl-2,3-dihydro-1H-tetrazol-5-yl)-3-(2,6-diisopropyl-phenyl)-urea::CHEMBL136851 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 14 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054284&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44357880 103950934 CHEMBL136851 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044126 CCCCCCCCCCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:14| InChI=1S/C26H46N6O/c1-6-7-8-9-10-11-12-13-14-15-19-32-30-25(29-31-32)28-26(33)27-24-22(20(2)3)17-16-18-23(24)21(4)5/h16-18,20-21,31H,6-15,19H2,1-5H3,(H3,27,28,29,30,33) YRKPVPVLUCDNRF-UHFFFAOYSA-N 50054302 1-(2,6-Diisopropyl-phenyl)-3-(2-dodecyl-2,3-dihydro-1H-tetrazol-5-yl)-urea::CHEMBL138229 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 14 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054302 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054302&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44358225 103950952 CHEMBL138229 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044127 CCCCCCCCCCCc1nnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)s1 InChI=1S/C26H42N4OS/c1-6-7-8-9-10-11-12-13-14-18-23-29-30-26(32-23)28-25(31)27-24-21(19(2)3)16-15-17-22(24)20(4)5/h15-17,19-20H,6-14,18H2,1-5H3,(H2,27,28,30,31) QCOFMEXLCQWSMG-UHFFFAOYSA-N 50054309 1-(2,6-Diisopropyl-phenyl)-3-(5-undecyl-[1,3,4]thiadiazol-2-yl)-urea::CHEMBL137118 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 390 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054309 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054309&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10527891 103950959 CHEMBL137118 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044129 CCCCCCCCCCCCCc1nnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)o1 InChI=1S/C28H46N4O2/c1-6-7-8-9-10-11-12-13-14-15-16-20-25-31-32-28(34-25)30-27(33)29-26-23(21(2)3)18-17-19-24(26)22(4)5/h17-19,21-22H,6-16,20H2,1-5H3,(H2,29,30,32,33) MYSYRAZWEDQJQS-UHFFFAOYSA-N 50054297 1-(2,6-Diisopropyl-phenyl)-3-(5-tridecyl-[1,3,4]oxadiazol-2-yl)-urea::CHEMBL442216 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 18 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054297 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054297&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10648064 103950947 CHEMBL442216 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044130 CCCCCCCCCCCCCS(=O)(=O)c1nnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)[nH]1 InChI=1S/C28H47N5O3S/c1-6-7-8-9-10-11-12-13-14-15-16-20-37(35,36)28-31-26(32-33-28)30-27(34)29-25-23(21(2)3)18-17-19-24(25)22(4)5/h17-19,21-22H,6-16,20H2,1-5H3,(H3,29,30,31,32,33,34) BVINHGIAJWVZON-UHFFFAOYSA-N 50054293 1-(2,6-Diisopropyl-phenyl)-3-[5-(tridecane-1-sulfonyl)-4H-[1,2,4]triazol-3-yl]-urea::CHEMBL136619 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 4700 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054293 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054293&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10744864 103950943 CHEMBL136619 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044131 CCCCCCCCCCCCc1nnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)[nH]1 InChI=1S/C27H45N5O/c1-6-7-8-9-10-11-12-13-14-15-19-24-28-26(32-31-24)30-27(33)29-25-22(20(2)3)17-16-18-23(25)21(4)5/h16-18,20-21H,6-15,19H2,1-5H3,(H3,28,29,30,31,32,33) ORQSBLPWXQKLNL-UHFFFAOYSA-N 50054287 1-(2,6-Diisopropyl-phenyl)-3-(5-dodecyl-4H-[1,2,4]triazol-3-yl)-urea::CHEMBL344172 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 4200 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054287 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054287&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10695098 103950937 CHEMBL344172 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044132 CCCCCCCCCCCCN1NN=C(CNC(=O)Nc2c(OC)cc(OC)cc2OC)N1 |t:14| InChI=1S/C24H42N6O4/c1-5-6-7-8-9-10-11-12-13-14-15-30-28-22(27-29-30)18-25-24(31)26-23-20(33-3)16-19(32-2)17-21(23)34-4/h16-17,29H,5-15,18H2,1-4H3,(H,27,28)(H2,25,26,31) LPWVUKBFNISZCI-UHFFFAOYSA-N 50054296 1-(2-Dodecyl-2,3-dihydro-1H-tetrazol-5-ylmethyl)-3-(2,4,6-trimethoxy-phenyl)-urea::CHEMBL134634 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 150 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054296 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054296&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44357954 103950946 CHEMBL134634 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044133 CCCCCCCCCCCCCc1cc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)on1 InChI=1S/C29H47N3O2/c1-6-7-8-9-10-11-12-13-14-15-16-18-24-21-27(34-32-24)30-29(33)31-28-25(22(2)3)19-17-20-26(28)23(4)5/h17,19-23H,6-16,18H2,1-5H3,(H2,30,31,33) TZPGCGKYHPPJRL-UHFFFAOYSA-N 50054281 1-(2,6-Diisopropyl-phenyl)-3-(3-tridecyl-isoxazol-5-yl)-urea::CHEMBL136276 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 13 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054281 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054281&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10838072 103950931 CHEMBL136276 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044134 CCCCCCCCCc1nnc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)s1 InChI=1S/C24H38N4OS/c1-6-7-8-9-10-11-12-16-21-27-28-24(30-21)26-23(29)25-22-19(17(2)3)14-13-15-20(22)18(4)5/h13-15,17-18H,6-12,16H2,1-5H3,(H2,25,26,28,29) APRSOUNCXMPULQ-UHFFFAOYSA-N 50054286 1-(2,6-Diisopropyl-phenyl)-3-(5-nonyl-[1,3,4]thiadiazol-2-yl)-urea::CHEMBL137031 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 150 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054286 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054286&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10574685 103950936 CHEMBL137031 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044135 CCCCCCCCCCCCCCc1cc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)on1 InChI=1S/C30H49N3O2/c1-6-7-8-9-10-11-12-13-14-15-16-17-19-25-22-28(35-33-25)31-30(34)32-29-26(23(2)3)20-18-21-27(29)24(4)5/h18,20-24H,6-17,19H2,1-5H3,(H2,31,32,34) ZVIOWPKJZALWHK-UHFFFAOYSA-N 50054304 1-(2,6-Diisopropyl-phenyl)-3-(3-tetradecyl-isoxazol-5-yl)-urea::CHEMBL424655 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 28 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054304 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054304&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10624692 103950954 CHEMBL424655 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044136 CCCCCCCCCN1NN=C(NC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:11| InChI=1S/C23H40N6O/c1-6-7-8-9-10-11-12-16-29-27-22(26-28-29)25-23(30)24-21-19(17(2)3)14-13-15-20(21)18(4)5/h13-15,17-18,28H,6-12,16H2,1-5H3,(H3,24,25,26,27,30) PGDMLOCBQJOJQW-UHFFFAOYSA-N 50054312 1-(2,6-Diisopropyl-phenyl)-3-(2-nonyl-2,3-dihydro-1H-tetrazol-5-yl)-urea::CHEMBL134364 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 31 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054312 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054312&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44357882 103950962 CHEMBL134364 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044137 CC(C)c1cccc(C(C)C)c1NC(=O)Nc1nnn(CCCCCCCCCCCOC2CCCCO2)n1 InChI=1S/C30H50N6O3/c1-23(2)25-17-16-18-26(24(3)4)28(25)31-30(37)32-29-33-35-36(34-29)20-13-10-8-6-5-7-9-11-14-21-38-27-19-12-15-22-39-27/h16-18,23-24,27H,5-15,19-22H2,1-4H3,(H2,31,32,34,37) ZLOZRXOWHFREHY-UHFFFAOYSA-N 50054313 1-(2,6-Diisopropyl-phenyl)-3-{2-[11-(tetrahydro-pyran-2-yloxy)-undecyl]-1H-tetrazol-5-yl}-urea::CHEMBL342412 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 37 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054313 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054313&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10650167 103950963 CHEMBL342412 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044138 CC(C)c1cccc(C(C)C)c1NC(=O)Nc1nnn[nH]1 InChI=1S/C14H20N6O/c1-8(2)10-6-5-7-11(9(3)4)12(10)15-14(21)16-13-17-19-20-18-13/h5-9H,1-4H3,(H3,15,16,17,18,19,20,21) WHSBFJDITCJAKW-UHFFFAOYSA-N 50054314 1-(2,6-Diisopropyl-phenyl)-3-(1H-tetrazol-5-yl)-urea::CHEMBL134850 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus >10000 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054314 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054314&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10708495 103950964 CHEMBL134850 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044139 CCCCCCCCCCCCN1NN=C(NC(=O)Nc2c(OC)cc(OC)cc2OC)N1 |t:14| InChI=1S/C23H40N6O4/c1-5-6-7-8-9-10-11-12-13-14-15-29-27-22(26-28-29)25-23(30)24-21-19(32-3)16-18(31-2)17-20(21)33-4/h16-17,28H,5-15H2,1-4H3,(H3,24,25,26,27,30) HNRMXEAGICHIAG-UHFFFAOYSA-N 50054301 1-(2-Dodecyl-2,3-dihydro-1H-tetrazol-5-yl)-3-(2,4,6-trimethoxy-phenyl)-urea::CHEMBL134687 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 66 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054301 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054301&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44357908 103950951 CHEMBL134687 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044140 CCCCCCCCCCc1cc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)on1 InChI=1S/C26H41N3O2/c1-6-7-8-9-10-11-12-13-15-21-18-24(31-29-21)27-26(30)28-25-22(19(2)3)16-14-17-23(25)20(4)5/h14,16-20H,6-13,15H2,1-5H3,(H2,27,28,30) SZHCMIYNUQMVGQ-UHFFFAOYSA-N 50054277 1-(3-Decyl-isoxazol-5-yl)-3-(2,6-diisopropyl-phenyl)-urea::CHEMBL335557 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 29 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054277 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054277&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 11796760 103950927 CHEMBL335557 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044141 CCCCCCCCCCCCn1nnnc1NC(=O)Nc1c(cccc1C(C)C)C(C)C InChI=1S/C26H44N6O/c1-6-7-8-9-10-11-12-13-14-15-19-32-25(29-30-31-32)28-26(33)27-24-22(20(2)3)17-16-18-23(24)21(4)5/h16-18,20-21H,6-15,19H2,1-5H3,(H2,27,28,29,31,33) WHYDGYMWIGMGGL-UHFFFAOYSA-N 50054291 1-(2,6-Diisopropyl-phenyl)-3-(1-dodecyl-1H-tetrazol-5-yl)-urea::CHEMBL136914 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 210 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054291 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054291&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10766242 103950941 CHEMBL136914 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50044142 CCCCCCCCCCCCN1NN=C(CNC(=O)Nc2c(cccc2C(C)C)C(C)C)N1 |t:14| InChI=1S/C27H48N6O/c1-6-7-8-9-10-11-12-13-14-15-19-33-31-25(30-32-33)20-28-27(34)29-26-23(21(2)3)17-16-18-24(26)22(4)5/h16-18,21-22,32H,6-15,19-20H2,1-5H3,(H,30,31)(H2,28,29,34) CSSITEDKQSXVJV-UHFFFAOYSA-N 50054279 1-(2,6-Diisopropyl-phenyl)-3-(2-dodecyl-2,3-dihydro-1H-tetrazol-5-ylmethyl)-urea::CHEMBL335801 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 12 ChEMBL 10.1021/jm960404v 10.7270/Q2571B3F 8893833 White, AD; Creswell, MW; Chucholowski, AW; Blankley, CJ; Wilson, MW; Bousley, RF; Essenburg, AD; Hamelehle, KL; Krause, BR; Stanfield, RL; Dominick, MA; Neub, M 12/10/1996 11/10/2009 Warner-Lambert http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054279 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054279&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 44357923 103950929 CHEMBL335801 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214