BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50043926 CCCN(CCC)C(=O)\C=C1/N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C25H24ClN3O2/c1-3-13-28(14-4-2)23(30)16-22-24-20(15-17-7-5-6-8-21(17)27-24)25(31)29(22)19-11-9-18(26)10-12-19/h5-12,15-16H,3-4,13-14H2,1-2H3 NXVPVFGSKVBDIO-UHFFFAOYSA-N 50454429 CHEMBL2111919 Translocator protein Rattus norvegicus >1000 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50454429 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50454429&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10598919 225146217 CHEMBL2111919 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043927 CCCN(CCC)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C25H24ClN3O2/c1-3-13-28(14-4-2)23(30)16-22-24-20(15-17-7-5-6-8-21(17)27-24)25(31)29(22)19-11-9-18(26)10-12-19/h5-12,15-16H,3-4,13-14H2,1-2H3 NXVPVFGSKVBDIO-UHFFFAOYSA-N 50054128 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N,N-dipropyl-acetamide::CHEMBL134590 Translocator protein Rattus norvegicus 2.7 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054128 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054128&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10526812 103950778 CHEMBL134590 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043933 CN(C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1)c1ccc(Cl)cc1 InChI=1S/C26H17Cl2N3O2/c1-30(19-10-6-17(27)7-11-19)24(32)15-23-25-21(14-16-4-2-3-5-22(16)29-25)26(33)31(23)20-12-8-18(28)9-13-20/h2-15H,1H3 ASUZPWSCVLEOFK-UHFFFAOYSA-N 50054126 (E)-N-(4-chlorophenyl)-2-(2-(4-chlorophenyl)-1-oxo-1,2-dihydropyrrolo[3,4-b]quinolin-3-ylidene)-N-methylacetamide::N-(4-Chloro-phenyl)-2-[2-(4-chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-methyl-acetamide::CHEMBL135869 Translocator protein Rattus norvegicus 1.1 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054126 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054126&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10528491 103950776 CHEMBL135869 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043937 COc1ccc(cc1)N(C)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C27H20ClN3O3/c1-30(19-11-13-21(34-2)14-12-19)25(32)16-24-26-22(15-17-5-3-4-6-23(17)29-26)27(33)31(24)20-9-7-18(28)8-10-20/h3-16H,1-2H3 MHBSCCHOLYAAGS-UHFFFAOYSA-N 50054125 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-(4-methoxy-phenyl)-N-methyl-acetamide::(E)-2-(2-(4-chlorophenyl)-1,2-dihydro-1-oxo-3H-pyrrolo[3,4-b]quinolin-3-ylidene-N-(4-metoxyphenyl)-N-methylacetamide::CHEMBL135870 Translocator protein Rattus norvegicus 1.7 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054125 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054125&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10672041 103950775 CHEMBL135870 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043941 COc1ccc(cc1)N(C)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C27H20ClN3O3/c1-30(19-11-13-21(34-2)14-12-19)25(32)16-24-26-22(15-17-5-3-4-6-23(17)29-26)27(33)31(24)20-9-7-18(28)8-10-20/h3-16H,1-2H3 MHBSCCHOLYAAGS-UHFFFAOYSA-N 50054125 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-(4-methoxy-phenyl)-N-methyl-acetamide::(E)-2-(2-(4-chlorophenyl)-1,2-dihydro-1-oxo-3H-pyrrolo[3,4-b]quinolin-3-ylidene-N-(4-metoxyphenyl)-N-methylacetamide::CHEMBL135870 Translocator protein Rattus norvegicus 9.8 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054125 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054125&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10672041 103950775 CHEMBL135870 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043944 COc1ccc(cc1)N(C)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C27H20ClN3O3/c1-30(19-11-13-21(34-2)14-12-19)25(32)16-24-26-22(15-17-5-3-4-6-23(17)29-26)27(33)31(24)20-9-7-18(28)8-10-20/h3-16H,1-2H3 MHBSCCHOLYAAGS-UHFFFAOYSA-N 50054125 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-(4-methoxy-phenyl)-N-methyl-acetamide::(E)-2-(2-(4-chlorophenyl)-1,2-dihydro-1-oxo-3H-pyrrolo[3,4-b]quinolin-3-ylidene-N-(4-metoxyphenyl)-N-methylacetamide::CHEMBL135870 Translocator protein Rattus norvegicus 0.700000 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054125 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054125&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10672041 103950775 CHEMBL135870 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043952 CN(C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1)c1ccc(Cl)cc1 InChI=1S/C26H17Cl2N3O2/c1-30(19-10-6-17(27)7-11-19)24(32)15-23-25-21(14-16-4-2-3-5-22(16)29-25)26(33)31(23)20-12-8-18(28)9-13-20/h2-15H,1H3 ASUZPWSCVLEOFK-UHFFFAOYSA-N 50054126 (E)-N-(4-chlorophenyl)-2-(2-(4-chlorophenyl)-1-oxo-1,2-dihydropyrrolo[3,4-b]quinolin-3-ylidene)-N-methylacetamide::N-(4-Chloro-phenyl)-2-[2-(4-chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-methyl-acetamide::CHEMBL135869 Translocator protein Rattus norvegicus 2.4 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054126 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054126&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10528491 103950776 CHEMBL135869 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043955 CCCN(CCC)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C25H24ClN3O2/c1-3-13-28(14-4-2)23(30)16-22-24-20(15-17-7-5-6-8-21(17)27-24)25(31)29(22)19-11-9-18(26)10-12-19/h5-12,15-16H,3-4,13-14H2,1-2H3 NXVPVFGSKVBDIO-UHFFFAOYSA-N 50054128 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N,N-dipropyl-acetamide::CHEMBL134590 Translocator protein Rattus norvegicus 120 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054128 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054128&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10526812 103950778 CHEMBL134590 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043965 COc1ccc(cc1)N(C)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C27H20ClN3O3/c1-30(19-11-13-21(34-2)14-12-19)25(32)16-24-26-22(15-17-5-3-4-6-23(17)29-26)27(33)31(24)20-9-7-18(28)8-10-20/h3-16H,1-2H3 MHBSCCHOLYAAGS-UHFFFAOYSA-N 50054125 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-(4-methoxy-phenyl)-N-methyl-acetamide::(E)-2-(2-(4-chlorophenyl)-1,2-dihydro-1-oxo-3H-pyrrolo[3,4-b]quinolin-3-ylidene-N-(4-metoxyphenyl)-N-methylacetamide::CHEMBL135870 Translocator protein Rattus norvegicus 1.9 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054125 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054125&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10672041 103950775 CHEMBL135870 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043967 CC[C@@H](C)N(C)C(=O)c1cc2ccccc2c(n1)c3ccccc3Cl InChI=1S/C21H21ClN2O/c1-4-14(2)24(3)21(25)19-13-15-9-5-6-10-16(15)20(23-19)17-11-7-8-12-18(17)22/h5-14H,4H2,1-3H3 RAVIZVQZGXBOQO-UHFFFAOYSA-N 22032 PK 11195::PK11195::RP 52028::N-(butan-2-yl)-1-(2-chlorophenyl)-N-methylisoquinoline-3-carboxamide::PK-11195::CHEMBL15313::1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxamide::[3H]PK 11195 Translocator protein Rattus norvegicus 1.8 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=22032 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=22032&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search PKA 2MGY,2N02,4RYI 1345 49845849 CHEMBL15313 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043968 CCCN(CCC)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C25H24ClN3O2/c1-3-13-28(14-4-2)23(30)16-22-24-20(15-17-7-5-6-8-21(17)27-24)25(31)29(22)19-11-9-18(26)10-12-19/h5-12,15-16H,3-4,13-14H2,1-2H3 NXVPVFGSKVBDIO-UHFFFAOYSA-N 50054128 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N,N-dipropyl-acetamide::CHEMBL134590 Translocator protein Rattus norvegicus 4.9 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054128 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054128&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10526812 103950778 CHEMBL134590 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043969 CN(C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1)c1ccc(Cl)cc1 InChI=1S/C26H17Cl2N3O2/c1-30(19-10-6-17(27)7-11-19)24(32)15-23-25-21(14-16-4-2-3-5-22(16)29-25)26(33)31(23)20-12-8-18(28)9-13-20/h2-15H,1H3 ASUZPWSCVLEOFK-UHFFFAOYSA-N 50054126 (E)-N-(4-chlorophenyl)-2-(2-(4-chlorophenyl)-1-oxo-1,2-dihydropyrrolo[3,4-b]quinolin-3-ylidene)-N-methylacetamide::N-(4-Chloro-phenyl)-2-[2-(4-chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-methyl-acetamide::CHEMBL135869 Translocator protein Rattus norvegicus 2.1 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054126 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054126&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10528491 103950776 CHEMBL135869 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043973 CCCN(CCC)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C25H24ClN3O2/c1-3-13-28(14-4-2)23(30)16-22-24-20(15-17-7-5-6-8-21(17)27-24)25(31)29(22)19-11-9-18(26)10-12-19/h5-12,15-16H,3-4,13-14H2,1-2H3 NXVPVFGSKVBDIO-UHFFFAOYSA-N 50054128 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N,N-dipropyl-acetamide::CHEMBL134590 Translocator protein Rattus norvegicus 40 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054128 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054128&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10526812 103950778 CHEMBL134590 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043974 CCCN(CCC)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C25H24ClN3O2/c1-3-13-28(14-4-2)23(30)16-22-24-20(15-17-7-5-6-8-21(17)27-24)25(31)29(22)19-11-9-18(26)10-12-19/h5-12,15-16H,3-4,13-14H2,1-2H3 NXVPVFGSKVBDIO-UHFFFAOYSA-N 50054128 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N,N-dipropyl-acetamide::CHEMBL134590 Translocator protein Rattus norvegicus 160 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054128 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054128&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10526812 103950778 CHEMBL134590 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043975 COc1ccc(cc1)N(C)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C27H20ClN3O3/c1-30(19-11-13-21(34-2)14-12-19)25(32)16-24-26-22(15-17-5-3-4-6-23(17)29-26)27(33)31(24)20-9-7-18(28)8-10-20/h3-16H,1-2H3 MHBSCCHOLYAAGS-UHFFFAOYSA-N 50054125 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-(4-methoxy-phenyl)-N-methyl-acetamide::(E)-2-(2-(4-chlorophenyl)-1,2-dihydro-1-oxo-3H-pyrrolo[3,4-b]quinolin-3-ylidene-N-(4-metoxyphenyl)-N-methylacetamide::CHEMBL135870 Translocator protein Rattus norvegicus 2.3 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054125 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054125&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10672041 103950775 CHEMBL135870 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043976 CN(C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1)c1ccc(Cl)cc1 InChI=1S/C26H17Cl2N3O2/c1-30(19-10-6-17(27)7-11-19)24(32)15-23-25-21(14-16-4-2-3-5-22(16)29-25)26(33)31(23)20-12-8-18(28)9-13-20/h2-15H,1H3 ASUZPWSCVLEOFK-UHFFFAOYSA-N 50054126 (E)-N-(4-chlorophenyl)-2-(2-(4-chlorophenyl)-1-oxo-1,2-dihydropyrrolo[3,4-b]quinolin-3-ylidene)-N-methylacetamide::N-(4-Chloro-phenyl)-2-[2-(4-chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-methyl-acetamide::CHEMBL135869 Translocator protein Rattus norvegicus 4.5 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054126 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054126&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10528491 103950776 CHEMBL135869 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043979 COc1ccc(cc1)N(C)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C27H20ClN3O3/c1-30(19-11-13-21(34-2)14-12-19)25(32)16-24-26-22(15-17-5-3-4-6-23(17)29-26)27(33)31(24)20-9-7-18(28)8-10-20/h3-16H,1-2H3 MHBSCCHOLYAAGS-UHFFFAOYSA-N 50054125 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-(4-methoxy-phenyl)-N-methyl-acetamide::(E)-2-(2-(4-chlorophenyl)-1,2-dihydro-1-oxo-3H-pyrrolo[3,4-b]quinolin-3-ylidene-N-(4-metoxyphenyl)-N-methylacetamide::CHEMBL135870 Translocator protein Rattus norvegicus 320 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054125 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054125&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10672041 103950775 CHEMBL135870 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043980 CN(C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1)c1ccc(Cl)cc1 InChI=1S/C26H17Cl2N3O2/c1-30(19-10-6-17(27)7-11-19)24(32)15-23-25-21(14-16-4-2-3-5-22(16)29-25)26(33)31(23)20-12-8-18(28)9-13-20/h2-15H,1H3 ASUZPWSCVLEOFK-UHFFFAOYSA-N 50054126 (E)-N-(4-chlorophenyl)-2-(2-(4-chlorophenyl)-1-oxo-1,2-dihydropyrrolo[3,4-b]quinolin-3-ylidene)-N-methylacetamide::N-(4-Chloro-phenyl)-2-[2-(4-chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-methyl-acetamide::CHEMBL135869 Translocator protein Rattus norvegicus 3.2 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054126 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054126&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10528491 103950776 CHEMBL135869 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043987 CN(C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1)c1ccc(Cl)cc1 InChI=1S/C26H17Cl2N3O2/c1-30(19-10-6-17(27)7-11-19)24(32)15-23-25-21(14-16-4-2-3-5-22(16)29-25)26(33)31(23)20-12-8-18(28)9-13-20/h2-15H,1H3 ASUZPWSCVLEOFK-UHFFFAOYSA-N 50054126 (E)-N-(4-chlorophenyl)-2-(2-(4-chlorophenyl)-1-oxo-1,2-dihydropyrrolo[3,4-b]quinolin-3-ylidene)-N-methylacetamide::N-(4-Chloro-phenyl)-2-[2-(4-chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-methyl-acetamide::CHEMBL135869 Translocator protein Rattus norvegicus 610 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054126 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054126&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10528491 103950776 CHEMBL135869 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50043988 CCCN(CCC)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C25H24ClN3O2/c1-3-13-28(14-4-2)23(30)16-22-24-20(15-17-7-5-6-8-21(17)27-24)25(31)29(22)19-11-9-18(26)10-12-19/h5-12,15-16H,3-4,13-14H2,1-2H3 NXVPVFGSKVBDIO-UHFFFAOYSA-N 50054128 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N,N-dipropyl-acetamide::CHEMBL134590 Translocator protein Rattus norvegicus 210 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054128 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054128&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10526812 103950778 CHEMBL134590 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089795 CCCN(CCC)C(=O)Cc1c(nc2ccc(Cl)cn12)-c1ccc(Cl)cc1 InChI=1S/C21H23Cl2N3O/c1-3-11-25(12-4-2)20(27)13-18-21(15-5-7-16(22)8-6-15)24-19-10-9-17(23)14-26(18)19/h5-10,14H,3-4,11-13H2,1-2H3 JRTIDHTUMYMPRU-UHFFFAOYSA-N 22041 2-[6-chloro-2-(4-chlorophenyl)imidazo[1,2-a]pyridin-3-yl]-N,N-dipropylacetamide::S-800342::Ananxyl::CHEMBL54349::Alpidem Translocator protein Rattus norvegicus 7 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=22041 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=22041&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 54897 49845858 CHEMBL54349 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089805 CCCCCCN(CCCCCC)C(=O)Cc1n(-c2ccc(Cl)cc2)c(=O)c2cc3ccccc3[nH]c12 InChI=1S/C31H38ClN3O2/c1-3-5-7-11-19-34(20-12-8-6-4-2)29(36)22-28-30-26(21-23-13-9-10-14-27(23)33-30)31(37)35(28)25-17-15-24(32)16-18-25/h9-10,13-18,21,33H,3-8,11-12,19-20,22H2,1-2H3 JJIMCMCBKRVGJH-UHFFFAOYSA-N 50054131 2-[2-(4-Chloro-phenyl)-1-oxo-2,3-dihydro-1H-pyrrolo[3,4-b]quinolin-3-yl]-N,N-dihexyl-acetamide::CHEMBL335049 Translocator protein Rattus norvegicus >1000 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054131 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054131&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 91929458 103950781 CHEMBL335049 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089811 CCCCCCN(CCCCCC)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C31H36ClN3O2/c1-3-5-7-11-19-34(20-12-8-6-4-2)29(36)22-28-30-26(21-23-13-9-10-14-27(23)33-30)31(37)35(28)25-17-15-24(32)16-18-25/h9-10,13-18,21-22H,3-8,11-12,19-20H2,1-2H3 BLWGATCPXZBNFN-UHFFFAOYSA-N 50054130 (E)-2-(2-(4-chlorophenyl)-1-oxo-1,2-dihydropyrrolo[3,4-b]quinolin-3-ylidene)-N,N-dihexylacetamide::2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N,N-dihexyl-acetamide::CHEMBL334887 Translocator protein Rattus norvegicus 150 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054130 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054130&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10506088 103950780 CHEMBL334887 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089813 CCCN(CCC)C(=O)\C=C1\N(C(=O)c2cccnc12)c1ccc(Cl)cc1 InChI=1S/C21H22ClN3O2/c1-3-12-24(13-4-2)19(26)14-18-20-17(6-5-11-23-20)21(27)25(18)16-9-7-15(22)8-10-16/h5-11,14H,3-4,12-13H2,1-2H3 QXRYSBDDBRGKOJ-UHFFFAOYSA-N 50054134 2-[6-(4-Chloro-phenyl)-5-oxo-5,6-dihydro-pyrrolo[3,4-b]pyridin-(7E)-ylidene]-N,N-dipropyl-acetamide::CHEMBL136030 Translocator protein Rattus norvegicus 290 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054134 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054134&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10500208 103950784 CHEMBL136030 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089814 CCCCCCN(CCCCCC)C(=O)Cc1n(-c2ccc(Cl)cc2)c(=O)c2ccc[nH]c12 InChI=1S/C27H36ClN3O2/c1-3-5-7-9-18-30(19-10-8-6-4-2)25(32)20-24-26-23(12-11-17-29-26)27(33)31(24)22-15-13-21(28)14-16-22/h11-17,29H,3-10,18-20H2,1-2H3 URMYAYHWIIBZNT-UHFFFAOYSA-N 50054135 2-[6-(4-Chloro-phenyl)-5-oxo-6,7-dihydro-5H-pyrrolo[3,4-b]pyridin-7-yl]-N,N-dihexyl-acetamide::CHEMBL135408 Translocator protein Rattus norvegicus 1600 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054135 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054135&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 91929461 103950785 CHEMBL135408 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089817 CCCN(CCC)C(=O)CC1N2C=C(Cl)C=CC2N=C1c1ccc(Cl)cc1 |c:15,19,t:12| InChI=1S/C21H25Cl2N3O/c1-3-11-25(12-4-2)20(27)13-18-21(15-5-7-16(22)8-6-15)24-19-10-9-17(23)14-26(18)19/h5-10,14,18-19H,3-4,11-13H2,1-2H3 AGKYWEYHIUTMKX-UHFFFAOYSA-N 50054127 2-[6-Chloro-2-(4-chloro-phenyl)-1,8a-dihydro-imidazo[1,2-a]pyridin-3-yl]-N,N-dipropyl-acetamide::CHEMBL137689 Translocator protein Rattus norvegicus 3.9 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054127 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054127&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 91929456 103950777 CHEMBL137689 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089824 CCCN(CCC)C(=O)Cc1n(-c2ccc(Cl)cc2)c(=O)c2cc3ccccc3[nH]c12 InChI=1S/C25H26ClN3O2/c1-3-13-28(14-4-2)23(30)16-22-24-20(15-17-7-5-6-8-21(17)27-24)25(31)29(22)19-11-9-18(26)10-12-19/h5-12,15,27H,3-4,13-14,16H2,1-2H3 KEZSTICUJXWFBV-UHFFFAOYSA-N 50054129 2-[2-(4-Chloro-phenyl)-1-oxo-2,3-dihydro-1H-pyrrolo[3,4-b]quinolin-3-yl]-N,N-dipropyl-acetamide::CHEMBL335388 Translocator protein Rattus norvegicus >1000 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054129 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054129&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 91929457 103950779 CHEMBL335388 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089826 Clc1ccc(cc1)-n1cc2[nH]cccc2c1=O InChI=1S/C13H9ClN2O/c14-9-3-5-10(6-4-9)16-8-12-11(13(16)17)2-1-7-15-12/h1-8,15H BABBUQVSIQRFEG-UHFFFAOYSA-N 50054133 6-(4-Chloro-phenyl)-6,7-dihydro-pyrrolo[3,4-b]pyridin-5-one::CHEMBL335923 Translocator protein Rattus norvegicus >1000 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054133 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054133&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 91929460 103950783 CHEMBL335923 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089829 CN(C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1)c1ccc(Cl)cc1 InChI=1S/C26H17Cl2N3O2/c1-30(19-10-6-17(27)7-11-19)24(32)15-23-25-21(14-16-4-2-3-5-22(16)29-25)26(33)31(23)20-12-8-18(28)9-13-20/h2-15H,1H3 ASUZPWSCVLEOFK-UHFFFAOYSA-N 50054126 (E)-N-(4-chlorophenyl)-2-(2-(4-chlorophenyl)-1-oxo-1,2-dihydropyrrolo[3,4-b]quinolin-3-ylidene)-N-methylacetamide::N-(4-Chloro-phenyl)-2-[2-(4-chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-methyl-acetamide::CHEMBL135869 Translocator protein Rattus norvegicus 140 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054126 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054126&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10528491 103950776 CHEMBL135869 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089830 CN(Cc1ccccc1)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C27H20ClN3O2/c1-30(17-18-7-3-2-4-8-18)25(32)16-24-26-22(15-19-9-5-6-10-23(19)29-26)27(33)31(24)21-13-11-20(28)12-14-21/h2-16H,17H2,1H3 LFAGETZMINAACK-UHFFFAOYSA-N 50054138 (E)-N-benzyl-2-(2-(4-chlorophenyl)-1-oxo-1,2-dihydropyrrolo[3,4-b]quinolin-3-ylidene)-N-methylacetamide::N-Benzyl-2-[2-(4-chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-methyl-acetamide::CHEMBL133313 Translocator protein Rattus norvegicus >1000 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054138 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054138&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10647349 103950788 CHEMBL133313 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089831 CCCCCCN(CCCCCC)C(=O)\C=C1\N(C(=O)c2cccnc12)c1ccc(Cl)cc1 InChI=1S/C27H34ClN3O2/c1-3-5-7-9-18-30(19-10-8-6-4-2)25(32)20-24-26-23(12-11-17-29-26)27(33)31(24)22-15-13-21(28)14-16-22/h11-17,20H,3-10,18-19H2,1-2H3 HCBTVYFCYYKDKD-UHFFFAOYSA-N 50054137 2-[6-(4-Chloro-phenyl)-5-oxo-5,6-dihydro-pyrrolo[3,4-b]pyridin-(7E)-ylidene]-N,N-dihexyl-acetamide::CHEMBL137730 Translocator protein Rattus norvegicus 33000 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054137 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054137&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10695584 103950787 CHEMBL137730 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089832 CCCN(CCC)C(=O)Cc1n(-c2ccc(Cl)cc2)c(=O)c2ccc[nH]c12 InChI=1S/C21H24ClN3O2/c1-3-12-24(13-4-2)19(26)14-18-20-17(6-5-11-23-20)21(27)25(18)16-9-7-15(22)8-10-16/h5-11,23H,3-4,12-14H2,1-2H3 VXEOUQBDROVPCS-UHFFFAOYSA-N 50054132 2-[6-(4-Chloro-phenyl)-5-oxo-6,7-dihydro-5H-pyrrolo[3,4-b]pyridin-7-yl]-N,N-dipropyl-acetamide::CHEMBL338738 Translocator protein Rattus norvegicus >1000 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054132 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054132&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 91929459 103950782 CHEMBL338738 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089835 COc1ccc(cc1)N(C)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C27H20ClN3O3/c1-30(19-11-13-21(34-2)14-12-19)25(32)16-24-26-22(15-17-5-3-4-6-23(17)29-26)27(33)31(24)20-9-7-18(28)8-10-20/h3-16H,1-2H3 MHBSCCHOLYAAGS-UHFFFAOYSA-N 50054125 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-(4-methoxy-phenyl)-N-methyl-acetamide::(E)-2-(2-(4-chlorophenyl)-1,2-dihydro-1-oxo-3H-pyrrolo[3,4-b]quinolin-3-ylidene-N-(4-metoxyphenyl)-N-methylacetamide::CHEMBL135870 Translocator protein Rattus norvegicus 14 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054125 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054125&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10672041 103950775 CHEMBL135870 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089837 CCCN(CCC)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C25H24ClN3O2/c1-3-13-28(14-4-2)23(30)16-22-24-20(15-17-7-5-6-8-21(17)27-24)25(31)29(22)19-11-9-18(26)10-12-19/h5-12,15-16H,3-4,13-14H2,1-2H3 NXVPVFGSKVBDIO-UHFFFAOYSA-N 50054128 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N,N-dipropyl-acetamide::CHEMBL134590 Translocator protein Rattus norvegicus 40 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054128 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054128&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10526812 103950778 CHEMBL134590 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257 50089841 CCN(Cc1ccccc1)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 InChI=1S/C28H22ClN3O2/c1-2-31(18-19-8-4-3-5-9-19)26(33)17-25-27-23(16-20-10-6-7-11-24(20)30-27)28(34)32(25)22-14-12-21(29)13-15-22/h3-17H,2,18H2,1H3 OWMPDKILHXPMPQ-UHFFFAOYSA-N 50054140 N-Benzyl-2-[2-(4-chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-ethyl-acetamide::(E)-N-benzyl-2-(2-(4-chlorophenyl)-1-oxo-1,2-dihydropyrrolo[3,4-b]quinolin-3-ylidene)-N-ethylacetamide::CHEMBL334761 Translocator protein Rattus norvegicus >1000 ChEMBL 10.1021/jm960325j 10.7270/Q22F7MHJ 8863805 Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS 11/25/1996 11/10/2009 Università http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50054140 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2236&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50054140&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search 10647966 103950790 CHEMBL334761 1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE Translocator protein TSPO_RAT P16257