BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 1286 COc1ccc2c(O)c(C(C3CC3)c3cccc(NS(=O)(=O)c4ccc(F)cc4)c3)c(=O)oc2c1 InChI=1S/C26H22FNO6S/c1-33-19-9-12-21-22(14-19)34-26(30)24(25(21)29)23(15-5-6-15)16-3-2-4-18(13-16)28-35(31,32)20-10-7-17(27)8-11-20/h2-4,7-15,23,28-29H,5-6H2,1H3 JPNYRBVKJYFOBV-UHFFFAOYSA-N 1167 N-{3-[cyclopropyl(4-hydroxy-7-methoxy-2-oxo-2H-chromen-3-yl)methyl]phenyl}-4-fluorobenzene-1-sulfonamide::N-[3-[Cyclopropyl(4-hydroxy-7-methoxy-2-oxo-2H-1-benzopyran-3-yl)methyl]phenyl]-4-fluorobenzenesulfonamide::Sulfonamide-Containing 4-Hydroxycoumarin deriv. VII Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 7.7 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1167 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1167&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688908 8031041 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1287 COc1ccc2c(O)c(C(C3CC3)c3cccc(NS(=O)(=O)c4ccc(cc4)C#N)c3)c(=O)oc2c1 InChI=1S/C27H22N2O6S/c1-34-20-9-12-22-23(14-20)35-27(31)25(26(22)30)24(17-7-8-17)18-3-2-4-19(13-18)29-36(32,33)21-10-5-16(15-28)6-11-21/h2-6,9-14,17,24,29-30H,7-8H2,1H3 PXMJLFGIXDKOBX-UHFFFAOYSA-N 1168 4-cyano-N-{3-[cyclopropyl(4-hydroxy-7-methoxy-2-oxo-2H-chromen-3-yl)methyl]phenyl}benzene-1-sulfonamide::N-[3-[Cyclopropyl(4-hydroxy-7-methoxy-2-oxo-2H-1-benzopyran-3-yl)methyl]phenyl]-4-cyanobenzenesulfonamide::Sulfonamide-Containing 4-Hydroxycoumarin deriv. VIII Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 5.8 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1168 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1168&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688909 8031042 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1288 COc1ccc2c(O)c(C(C3CC3)c3cccc(NS(=O)(=O)c4cccc5cccnc45)c3)c(=O)oc2c1 InChI=1S/C29H24N2O6S/c1-36-21-12-13-22-23(16-21)37-29(33)26(28(22)32)25(17-10-11-17)19-6-2-8-20(15-19)31-38(34,35)24-9-3-5-18-7-4-14-30-27(18)24/h2-9,12-17,25,31-32H,10-11H2,1H3 VIWOOVZGEDFUGH-UHFFFAOYSA-N 1169 N-{3-[cyclopropyl(4-hydroxy-7-methoxy-2-oxo-2H-chromen-3-yl)methyl]phenyl}quinoline-8-sulfonamide::N-[3-[Cyclopropyl(4-hydroxy-7-methoxy-2-oxo-2H-1-benzopyran-3-yl)methyl]phenyl]-8-quinolinesulfonamide::Sulfonamide-Containing 4-Hydroxycoumarin deriv. IX Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 4.9 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1169 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1169&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688910 8031043 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1289 COc1ccc2c(O)c(C(C3CC3)c3cccc(NS(=O)(=O)c4cn(C)cn4)c3)c(=O)oc2c1 InChI=1S/C24H23N3O6S/c1-27-12-20(25-13-27)34(30,31)26-16-5-3-4-15(10-16)21(14-6-7-14)22-23(28)18-9-8-17(32-2)11-19(18)33-24(22)29/h3-5,8-14,21,26,28H,6-7H2,1-2H3 FVCKWPQMLLACPQ-UHFFFAOYSA-N 1170 N-[3-[Cyclopropyl(4-hydroxy-7-methoxy-2-oxo-2H-1-benzopyran-3-yl)methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::N-{3-[cyclopropyl(4-hydroxy-7-methoxy-2-oxo-2H-chromen-3-yl)methyl]phenyl}-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxycoumarin deriv. X Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 0.7 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1170 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1170&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688911 8031044 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1290 Cc1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3cn(C)cn3)c2)c(=O)o1 InChI=1S/C20H21N3O5S/c1-12-8-16(24)19(20(25)28-12)18(13-6-7-13)14-4-3-5-15(9-14)22-29(26,27)17-10-23(2)11-21-17/h3-5,8-11,13,18,22,24H,6-7H2,1-2H3 JMVUOXLBVAOZCN-UHFFFAOYSA-N 1171 N-[3-[Cyclopropyl(4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl)methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::N-{3-[cyclopropyl(4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl)methyl]phenyl}-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XI Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 14 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1171 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1171&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688912 8031045 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1291 CCCc1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3cn(C)cn3)c2)c(=O)o1 InChI=1S/C22H25N3O5S/c1-3-5-17-11-18(26)21(22(27)30-17)20(14-8-9-14)15-6-4-7-16(10-15)24-31(28,29)19-12-25(2)13-23-19/h4,6-7,10-14,20,24,26H,3,5,8-9H2,1-2H3 AHSQZQWEKNDRIX-UHFFFAOYSA-N 1172 N-{3-[cyclopropyl(4-hydroxy-2-oxo-6-propyl-2H-pyran-3-yl)methyl]phenyl}-1-methyl-1H-imidazole-4-sulfonamide::N-[3-[Cyclopropyl(4-hydroxy-2-oxo-6-propyl-2H-pyran-3-yl)methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XII Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 1.4 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1172 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1172&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688913 8031046 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1292 Cn1cnc(c1)S(=O)(=O)Nc1cccc(c1)C(C1CC1)c1c(O)cc(CCc2ccccc2)oc1=O InChI=1S/C27H27N3O5S/c1-30-16-24(28-17-30)36(33,34)29-21-9-5-8-20(14-21)25(19-11-12-19)26-23(31)15-22(35-27(26)32)13-10-18-6-3-2-4-7-18/h2-9,14-17,19,25,29,31H,10-13H2,1H3 OKNWBOKCZOFVKS-UHFFFAOYSA-N 1173 N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(2-phenylethyl)-2H-pyran-3-yl]methyl}phenyl)-1-methyl-1H-imidazole-4-sulfonamide::N-[3-[Cyclopropyl(4-hydroxy-2-oxo-6-(2-phenylethyl)-2H-pyran-3-yl)methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XIII Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 0.97 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1173 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1173&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688914 8031047 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1293 COCCOCCCc1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3cn(C)cn3)c2)c(=O)o1 InChI=1S/C25H31N3O7S/c1-28-15-22(26-16-28)36(31,32)27-19-6-3-5-18(13-19)23(17-8-9-17)24-21(29)14-20(35-25(24)30)7-4-10-34-12-11-33-2/h3,5-6,13-17,23,27,29H,4,7-12H2,1-2H3 MEMPZWYMKIENFT-UHFFFAOYSA-N 1174 N-{3-[cyclopropyl({4-hydroxy-6-[3-(2-methoxyethoxy)propyl]-2-oxo-2H-pyran-3-yl})methyl]phenyl}-1-methyl-1H-imidazole-4-sulfonamide::N-[3-[Cyclopropyl[6-[3-(2-methoxyethoxy)propyl]-4-hydroxy-2-oxo-2H-pyran-3-yl)methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XIV Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 1.6 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1174 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1174&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688915 8031048 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1294 CCC(CC)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3cn(C)cn3)c2)c(=O)o1 InChI=1S/C24H29N3O5S/c1-4-15(5-2)20-12-19(28)23(24(29)32-20)22(16-9-10-16)17-7-6-8-18(11-17)26-33(30,31)21-13-27(3)14-25-21/h6-8,11-16,22,26,28H,4-5,9-10H2,1-3H3 RITIXPBLKVIIFG-UHFFFAOYSA-N 1175 N-[3-[Cyclopropyl[6-(1-ethylpropyl)-4-hydroxy-2-oxo-2H-pyran-3-yl)methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(pentan-3-yl)-2H-pyran-3-yl]methyl}phenyl)-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XV Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 0.54 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1175 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1175&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688916 8031049 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1295 Cn1cnc(c1)S(=O)(=O)Nc1cccc(c1)C(C1CC1)c1c(O)cc(oc1=O)C(CC1CC1)CC1CC1 InChI=1S/C28H33N3O5S/c1-31-15-25(29-16-31)37(34,35)30-22-4-2-3-20(13-22)26(19-9-10-19)27-23(32)14-24(36-28(27)33)21(11-17-5-6-17)12-18-7-8-18/h2-4,13-19,21,26,30,32H,5-12H2,1H3 IMXXWUHDQINZEB-UHFFFAOYSA-N 1176 N-(3-{cyclopropyl[6-(1,3-dicyclopropylpropan-2-yl)-4-hydroxy-2-oxo-2H-pyran-3-yl]methyl}phenyl)-1-methyl-1H-imidazole-4-sulfonamide::N-[3-[Cyclopropyl[6-[2-cyclopropyl-1-(cyclopropyl-methyl)ethyl]-4-hydroxy-2-oxo-2H-pyran-3-yl)methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XVI Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 1.0 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1176 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1176&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688917 8031050 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1296 COCCOCCC(CCOCCOC)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3cn(C)cn3)c2)c(=O)o1 InChI=1S/C30H41N3O9S/c1-33-19-27(31-20-33)43(36,37)32-24-6-4-5-23(17-24)28(22-7-8-22)29-25(34)18-26(42-30(29)35)21(9-11-40-15-13-38-2)10-12-41-16-14-39-3/h4-6,17-22,28,32,34H,7-16H2,1-3H3 KHHLYBOHRSWBOZ-UHFFFAOYSA-N 1177 N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(2,5,11,14-tetraoxapentadecan-8-yl)-2H-pyran-3-yl]methyl}phenyl)-1-methyl-1H-imidazole-4-sulfonamide::N-[3-[Cyclopropyl[6-[1-[2-(methoxyethoxy)ethyl]-3-(2-methoxyethoxy)propyl]-4-hydroxy-2-oxo-2H-pyran-3-yl)methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XVII Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 4.2 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1177 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1177&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688918 8031051 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1297 CCC(Cc1ccccc1)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3cn(C)cn3)c2)c(=O)o1 InChI=1S/C29H31N3O5S/c1-3-20(14-19-8-5-4-6-9-19)25-16-24(33)28(29(34)37-25)27(21-12-13-21)22-10-7-11-23(15-22)31-38(35,36)26-17-32(2)18-30-26/h4-11,15-18,20-21,27,31,33H,3,12-14H2,1-2H3 AJPKIPJBVMYDNN-UHFFFAOYSA-N 1178 N-[3-[[S or R]-Cyclopropyl[4-hydroxy-2-oxo-6-[1(S)-(phenylmethyl)propyl]-2H-pyran-3-yl]methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(1-phenylbutan-2-yl)-2H-pyran-3-yl]methyl}phenyl)-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XVIII Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 1.3 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1178 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1178&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688919 8031052 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1298 CCC(CC1CCOCC1)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3cn(C)cn3)c2)c(=O)o1 InChI=1S/C28H35N3O6S/c1-3-19(13-18-9-11-36-12-10-18)24-15-23(32)27(28(33)37-24)26(20-7-8-20)21-5-4-6-22(14-21)30-38(34,35)25-16-31(2)17-29-25/h4-6,14-20,26,30,32H,3,7-13H2,1-2H3 QPDCJMXOIJUAPY-UHFFFAOYSA-N 1179 N-[3-[Cyclopropyl[4-hydroxy-2-oxo-6-[1-[(tetrahydro-2H-pyran-4-yl)methyl]phenyl]-2H-pyran-3-yl]methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::N-{3-[cyclopropyl({4-hydroxy-6-[1-(oxan-4-yl)butan-2-yl]-2-oxo-2H-pyran-3-yl})methyl]phenyl}-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XIX Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 0.48 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1179 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1179&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688920 8031053 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1299 CCC(CCOCCOC)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3cn(C)cn3)c2)c(=O)o1 InChI=1S/C27H35N3O7S/c1-4-18(10-11-36-13-12-35-3)23-15-22(31)26(27(32)37-23)25(19-8-9-19)20-6-5-7-21(14-20)29-38(33,34)24-16-30(2)17-28-24/h5-7,14-19,25,29,31H,4,8-13H2,1-3H3 SMABGRXWDGFPEH-UHFFFAOYSA-N 1180 N-[3-[Cyclopropyl[6-[1-ethyl-3-(2-methoxyethoxy)propyl]-4-hydroxy-2-oxo-2H-pyran-3-yl]methyl]phenyl]-1-methyl-1H-imidazole-4-sulfonamide::N-{3-[cyclopropyl({4-hydroxy-6-[1-(2-methoxyethoxy)pentan-3-yl]-2-oxo-2H-pyran-3-yl})methyl]phenyl}-1-methyl-1H-imidazole-4-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XX Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 0.88 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1180 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1180&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688921 8031054 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1300 Oc1cc(oc(=O)c1C(C1CC1)c1cccc(NS(=O)(=O)c2ccccc2)c1)C(CC1CC1)CC1CC1 InChI=1S/C30H33NO5S/c32-26-18-27(23(15-19-9-10-19)16-20-11-12-20)36-30(33)29(26)28(21-13-14-21)22-5-4-6-24(17-22)31-37(34,35)25-7-2-1-3-8-25/h1-8,17-21,23,28,31-32H,9-16H2 WABOALMCZNGCSN-UHFFFAOYSA-N 1181 N-[3-[Cyclopropyl[6-[2-cyclopropyl-1-(cyclopropyl-methyl)ethyl]-4-hydroxy-2-oxo-2H-pyran-3-yl]methyl]phenyl]benzenesulfonamide::N-(3-{cyclopropyl[6-(1,3-dicyclopropylpropan-2-yl)-4-hydroxy-2-oxo-2H-pyran-3-yl]methyl}phenyl)benzenesulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXI Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 23 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1181 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1181&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688922 8031055 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1301 Oc1cc(oc(=O)c1C(C1CC1)c1cccc(NS(=O)(=O)c2ccc(F)cc2)c1)C(CC1CC1)CC1CC1 InChI=1S/C30H32FNO5S/c31-23-10-12-25(13-11-23)38(35,36)32-24-3-1-2-21(16-24)28(20-8-9-20)29-26(33)17-27(37-30(29)34)22(14-18-4-5-18)15-19-6-7-19/h1-3,10-13,16-20,22,28,32-33H,4-9,14-15H2 SLZNWUVSDZUVTO-UHFFFAOYSA-N 1182 N-(3-{cyclopropyl[6-(1,3-dicyclopropylpropan-2-yl)-4-hydroxy-2-oxo-2H-pyran-3-yl]methyl}phenyl)-4-fluorobenzene-1-sulfonamide::CHEMBL80882::N-[3-[Cyclopropyl[6-[2-cyclopropyl-1-(cyclopropyl-methyl)ethyl]-4-hydroxy-2-oxo-2H-pyran-3-yl]methyl]phenyl]-4-flurobenzenesulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXII Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 16 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1182 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1182&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688923 8031056 CHEMBL80882 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1302 Oc1cc(oc(=O)c1C(C1CC1)c1cccc(NS(=O)(=O)c2ccc(cc2)C#N)c1)C(CC1CC1)CC1CC1 InChI=1S/C31H32N2O5S/c32-18-21-8-12-26(13-9-21)39(36,37)33-25-3-1-2-23(16-25)29(22-10-11-22)30-27(34)17-28(38-31(30)35)24(14-19-4-5-19)15-20-6-7-20/h1-3,8-9,12-13,16-17,19-20,22,24,29,33-34H,4-7,10-11,14-15H2 GDZNOQJDTRZGEW-UHFFFAOYSA-N 1183 N-[3-[Cyclopropyl[6-[2-cyclopropyl-1-(cyclopropyl-methyl)ethyl]-4-hydroxy-2-oxo-2H-pyran-3-yl]methyl]phenyl]-4-cyanobenzenesulfonamide::4-cyano-N-(3-{cyclopropyl[6-(1,3-dicyclopropylpropan-2-yl)-4-hydroxy-2-oxo-2H-pyran-3-yl]methyl}phenyl)benzene-1-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXIII Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 5.4 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1183 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1183&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688924 8031057 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1303 Oc1cc(oc(=O)c1C(C1CC1)c1cccc(NS(=O)(=O)c2cccc3cccnc23)c1)C(CC1CC1)CC1CC1 InChI=1S/C33H34N2O5S/c36-27-19-28(25(16-20-9-10-20)17-21-11-12-21)40-33(37)31(27)30(22-13-14-22)24-5-1-7-26(18-24)35-41(38,39)29-8-2-4-23-6-3-15-34-32(23)29/h1-8,15,18-22,25,30,35-36H,9-14,16-17H2 HJKNBMVMDDGJBX-UHFFFAOYSA-N 1184 N-[3-[Cyclopropyl[6-[2-cyclopropyl-1-(cyclopropyl-methyl)ethyl]-4-hydroxy-2-oxo-2H-pyran-3-yl]methyl]phenyl]-8-quinolinesulfonamide::N-(3-{cyclopropyl[6-(1,3-dicyclopropylpropan-2-yl)-4-hydroxy-2-oxo-2H-pyran-3-yl]methyl}phenyl)quinoline-8-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXIV Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 5.3 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1184 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1184&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688925 8031058 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1304 CCCS(=O)(=O)Nc1cccc(c1)C(C1CC1)c1c(O)cc(oc1=O)C(CC)Cc1ccccc1 InChI=1S/C28H33NO5S/c1-3-15-35(32,33)29-23-12-8-11-22(17-23)26(21-13-14-21)27-24(30)18-25(34-28(27)31)20(4-2)16-19-9-6-5-7-10-19/h5-12,17-18,20-21,26,29-30H,3-4,13-16H2,1-2H3 GTGPHAUFYVHIIY-UHFFFAOYSA-N 1185 N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(1-phenylbutan-2-yl)-2H-pyran-3-yl]methyl}phenyl)propane-1-sulfonamide::N-[3-[Cyclopropyl(4-hydroxy-2-oxo-6-[1-(phenylmethyl)propyl]-2H-pyran-3-yl]methyl]phenyl]propanesulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXV Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 40 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1185 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1185&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688926 8031059 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1305 CCC(Cc1ccccc1)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3ccccc3)c2)c(=O)o1 InChI=1S/C31H31NO5S/c1-2-22(18-21-10-5-3-6-11-21)28-20-27(33)30(31(34)37-28)29(23-16-17-23)24-12-9-13-25(19-24)32-38(35,36)26-14-7-4-8-15-26/h3-15,19-20,22-23,29,32-33H,2,16-18H2,1H3 KPHRDRFCGGZQJY-UHFFFAOYSA-N 1186 N-[3-[Cyclopropyl[4-hydroxy-2-oxo-6-[1-(phenylmethyl)propyl]2H-pyran-3-yl)methyl]phenyl]benzenesulfonamide::N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(1-phenylbutan-2-yl)-2H-pyran-3-yl]methyl}phenyl)benzenesulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXVI Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 17 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1186 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1186&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688927 8031060 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1306 CCC(Cc1ccccc1)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3ccc(OC)cc3)c2)c(=O)o1 InChI=1S/C32H33NO6S/c1-3-22(18-21-8-5-4-6-9-21)29-20-28(34)31(32(35)39-29)30(23-12-13-23)24-10-7-11-25(19-24)33-40(36,37)27-16-14-26(38-2)15-17-27/h4-11,14-17,19-20,22-23,30,33-34H,3,12-13,18H2,1-2H3 VEXRXPAIHVICKW-UHFFFAOYSA-N 1187 N-[3-[Cyclopropyl[4-hydroxy-2-oxo-6-[1-(phenylmethyl)propyl]2H-pyran-3-yl)methyl]phenyl]-4-methoxybenzenesulfonamide::N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(1-phenylbutan-2-yl)-2H-pyran-3-yl]methyl}phenyl)-4-methoxybenzene-1-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXVII Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 22 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1187 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1187&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688928 8031061 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1307 CCC(Cc1ccccc1)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3ccc(Cl)cc3)c2)c(=O)o1 InChI=1S/C31H30ClNO5S/c1-2-21(17-20-7-4-3-5-8-20)28-19-27(34)30(31(35)38-28)29(22-11-12-22)23-9-6-10-25(18-23)33-39(36,37)26-15-13-24(32)14-16-26/h3-10,13-16,18-19,21-22,29,33-34H,2,11-12,17H2,1H3 SEUIMKBYBKTVTL-UHFFFAOYSA-N 1188 4-chloro-N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(1-phenylbutan-2-yl)-2H-pyran-3-yl]methyl}phenyl)benzene-1-sulfonamide::N-[3-[Cyclopropyl[4-hydroxy-2-oxo-6-[1-(phenylmethyl)propyl]2H-pyran-3-yl)methyl]phenyl]-4-chlorobenzenesulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXVIII Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 15 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1188 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1188&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688929 8031062 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1308 CCC(Cc1ccccc1)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3ccc(cc3)C#N)c2)c(=O)o1 InChI=1S/C32H30N2O5S/c1-2-23(17-21-7-4-3-5-8-21)29-19-28(35)31(32(36)39-29)30(24-13-14-24)25-9-6-10-26(18-25)34-40(37,38)27-15-11-22(20-33)12-16-27/h3-12,15-16,18-19,23-24,30,34-35H,2,13-14,17H2,1H3 OCXOYYFOGHBUKE-UHFFFAOYSA-N 1189 4-cyano-N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(1-phenylbutan-2-yl)-2H-pyran-3-yl]methyl}phenyl)benzene-1-sulfonamide::N-[3-[Cyclopropyl[4-hydroxy-2-oxo-6-[1-(phenylmethyl)propyl]2H-pyran-3-yl)methyl]phenyl]-4-cyanobenzenesulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXIX Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 5.7 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1189 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1189&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54682808 8031063 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1309 CCC(Cc1ccccc1)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3cccnc3)c2)c(=O)o1 InChI=1S/C30H30N2O5S/c1-2-21(16-20-8-4-3-5-9-20)27-18-26(33)29(30(34)37-27)28(22-13-14-22)23-10-6-11-24(17-23)32-38(35,36)25-12-7-15-31-19-25/h3-12,15,17-19,21-22,28,32-33H,2,13-14,16H2,1H3 AQMCGYBGJJWMDS-UHFFFAOYSA-N 1190 N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(1-phenylbutan-2-yl)-2H-pyran-3-yl]methyl}phenyl)pyridine-3-sulfonamide::N-[3-[Cyclopropyl[4-hydroxy-2-oxo-6-[1-(phenylmethyl)propyl]2H-pyran-3-yl)methyl]phenyl]-3-pyridinesulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXX Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 12 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1190 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1190&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688930 8031064 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497 1310 CCC(Cc1ccccc1)c1cc(O)c(C(C2CC2)c2cccc(NS(=O)(=O)c3cccc4cccnc34)c2)c(=O)o1 InChI=1S/C34H32N2O5S/c1-2-23(19-22-9-4-3-5-10-22)29-21-28(37)32(34(38)41-29)31(24-16-17-24)26-12-6-14-27(20-26)36-42(39,40)30-15-7-11-25-13-8-18-35-33(25)30/h3-15,18,20-21,23-24,31,36-37H,2,16-17,19H2,1H3 UDNCOTKJZZVWPV-UHFFFAOYSA-N 1191 N-[3-[Cyclopropyl[4-hydroxy-2-oxo-6-[1-(phenylmethyl)propyl]2H-pyran-3-yl)methyl]phenyl]-8-quinoline-sulfonamide::N-(3-{cyclopropyl[4-hydroxy-2-oxo-6-(1-phenylbutan-2-yl)-2H-pyran-3-yl]methyl}phenyl)quinoline-8-sulfonamide::Sulfonamide-Containing 4-Hydroxy-2-pyrone deriv. XXXI Dimer of Gag-Pol polyprotein [489-587] Human immunodeficiency virus 1 3.5 5.0000 22.00 C Curated from the literature by BindingDB 10.1021/jm950888f 10.7270/Q20K26RK 8691434 aid1795300 Thaisrivongs, S; Janakiraman, MN; Chong, KT; Tomich, PK; Dolak, LA; Turner, SR; Strohbach, JW; Lynn, JC; Horng, MM; Hinshaw, RR; Watenpaugh, KD 6/7/1996 9/23/2004 Upjohn http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=1191 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50&target=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=1191&enzyme=Dimer+of+Gag-Pol+polyprotein+%5B489-587%5D&column=ki&startPg=0&Increment=50&submit=Search 54688931 8031065 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 9HVP,7YF6,7WCQ,7WBS,6OYR,6OYD,6OGP,6MCS,6MCR,5IVS,5IVR,5IVQ,5HVP,4PHV,4LL3,3S85,3M9F,2QMP,2HVP,1VIK,1VIJ,1SBG,1PRO,1IZH,1HXW,1EBY,1A8G Gag-Pol polyprotein POL_HV1N5 P12497