BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50045895 CCCCCCCCCCC1(CCCC1)C(=O)Nc1c2OC(C)(C)Cc2c(C)cc1C InChI=1S/C28H45NO2/c1-6-7-8-9-10-11-12-13-16-28(17-14-15-18-28)26(30)29-24-22(3)19-21(2)23-20-27(4,5)31-25(23)24/h19H,6-18,20H2,1-5H3,(H,29,30) IEFXMGZBEZKSAM-UHFFFAOYSA-N 50050358 1-Decyl-cyclopentanecarboxylic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL282897 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 170 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050358 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050358&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10622416 103947545 CHEMBL282897 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045896 CCCCCCCCCCC1(CCCC1)C(=O)Nc1cccc2CC(C)(C)Oc12 InChI=1S/C26H41NO2/c1-4-5-6-7-8-9-10-11-17-26(18-12-13-19-26)24(28)27-22-16-14-15-21-20-25(2,3)29-23(21)22/h14-16H,4-13,17-20H2,1-3H3,(H,27,28) JTOROIYOKKKESY-UHFFFAOYSA-N 50050378 1-Decyl-cyclopentanecarboxylic acid (2,2-dimethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23084 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 500 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050378 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050378&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10668652 103947565 CHEMBL23084 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045899 CCCCCCCCCCC(C)(C)C(=O)Nc1c2OC(C)(C)Cc2c(C)c(c1C)[N+]([O-])=O InChI=1S/C26H42N2O4/c1-8-9-10-11-12-13-14-15-16-25(4,5)24(29)27-21-19(3)22(28(30)31)18(2)20-17-26(6,7)32-23(20)21/h8-17H2,1-7H3,(H,27,29) VTJXSPJPNGQWDN-UHFFFAOYSA-N 50050352 2,2-Dimethyl-dodecanoic acid (2,2,4,6-tetramethyl-5-nitro-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL279228 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 36 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050352 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050352&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10813284 103947539 CHEMBL279228 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045905 CCCCCCCCCCC(C)(C)C(=O)Nc1c(cc(cc1OC)OC)OC InChI=1S/C23H39NO4/c1-7-8-9-10-11-12-13-14-15-23(2,3)22(25)24-21-19(27-5)16-18(26-4)17-20(21)28-6/h16-17H,7-15H2,1-6H3,(H,24,25) WAFNZAURAWBNDZ-UHFFFAOYSA-N 50005944 2,2-Dimethyl-dodecanoic acid (2,4,6-trimethoxy-phenyl)-amide::CHEMBL22373::CI-976 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 140 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50005944 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50005944&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search E5L 6L47 122327 103919368 CHEMBL22373 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045906 CCCCCCCCCCC(C)(C)C(=O)Nc1c(OC)ccc2C(=O)CCOc12 InChI=1S/C24H37NO4/c1-5-6-7-8-9-10-11-12-16-24(2,3)23(27)25-21-20(28-4)14-13-18-19(26)15-17-29-22(18)21/h13-14H,5-12,15-17H2,1-4H3,(H,25,27) DJBINNZKEHJIFK-UHFFFAOYSA-N 50050362 2,2-Dimethyl-dodecanoic acid (7-methoxy-4-oxo-chroman-8-yl)-amide::CHEMBL278856 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 13 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050362 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050362&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 9953017 103947549 CHEMBL278856 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045908 CCCCCCCCCCCCOc1ccc(cc1)C(=O)Nc1c2OC(C)(C)Cc2c(C)cc1C InChI=1S/C31H45NO3/c1-6-7-8-9-10-11-12-13-14-15-20-34-26-18-16-25(17-19-26)30(33)32-28-24(3)21-23(2)27-22-31(4,5)35-29(27)28/h16-19,21H,6-15,20,22H2,1-5H3,(H,32,33) PLGJAUXLLCERRL-UHFFFAOYSA-N 50050355 4-Dodecyloxy-N-(2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-benzamide::CHEMBL23775 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 90 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050355 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050355&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10696066 103947542 CHEMBL23775 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045910 CCCOCCCCCCOc1ccc(cc1)C(=O)Nc1c2OC(C)(C)Cc2c(C)cc1C InChI=1S/C28H39NO4/c1-6-15-31-16-9-7-8-10-17-32-23-13-11-22(12-14-23)27(30)29-25-21(3)18-20(2)24-19-28(4,5)33-26(24)25/h11-14,18H,6-10,15-17,19H2,1-5H3,(H,29,30) VRKDKUGWQZIWGZ-UHFFFAOYSA-N 50050369 4-(6-Propoxy-hexyloxy)-N-(2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-benzamide::CHEMBL281144 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus >200 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050369 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050369&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10766118 103947556 CHEMBL281144 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045912 CCCCCCCCCCCCCCCC(=O)Nc1c2OC(C)(C)Cc2ccc1C InChI=1S/C27H45NO2/c1-5-6-7-8-9-10-11-12-13-14-15-16-17-18-24(29)28-25-22(2)19-20-23-21-27(3,4)30-26(23)25/h19-20H,5-18,21H2,1-4H3,(H,28,29) CZKHKIWJFGVFMT-UHFFFAOYSA-N 50050367 Hexadecanoic acid (2,2,6-trimethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23476 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 24 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050367 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050367&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10835676 103947554 CHEMBL23476 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045914 CC(C)COCCCCCCC(C)(C)C(=O)Nc1c2OC(C)(C)Cc2c(C)cc1C InChI=1S/C26H43NO3/c1-18(2)17-29-14-12-10-9-11-13-25(5,6)24(28)27-22-20(4)15-19(3)21-16-26(7,8)30-23(21)22/h15,18H,9-14,16-17H2,1-8H3,(H,27,28) RQBSIMXUAVWAFW-UHFFFAOYSA-N 50050376 8-Isobutoxy-2,2-dimethyl-octanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23624 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 59 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050376 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050376&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10549908 103947563 CHEMBL23624 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045917 CCCCCCCCCCOc1ccc(cc1)C(=O)Nc1c2OC(C)(C)Cc2c(C)cc1C InChI=1S/C29H41NO3/c1-6-7-8-9-10-11-12-13-18-32-24-16-14-23(15-17-24)28(31)30-26-22(3)19-21(2)25-20-29(4,5)33-27(25)26/h14-17,19H,6-13,18,20H2,1-5H3,(H,30,31) GNBJGMPVXXXRLO-UHFFFAOYSA-N 50050364 4-Decyloxy-N-(2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-benzamide::CHEMBL23740 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 30 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050364 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050364&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10599704 103947551 CHEMBL23740 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045918 Cc1cc(C)c(NC(=O)c2ccc(OCCCCCCOc3ccc(Cl)cc3)cc2)c2OC(C)(C)Cc12 InChI=1S/C31H36ClNO4/c1-21-19-22(2)28(29-27(21)20-31(3,4)37-29)33-30(34)23-9-13-25(14-10-23)35-17-7-5-6-8-18-36-26-15-11-24(32)12-16-26/h9-16,19H,5-8,17-18,20H2,1-4H3,(H,33,34) DTWOCKYJSMUFFN-UHFFFAOYSA-N 50050353 4-[6-(4-Chloro-phenoxy)-hexyloxy]-N-(2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-benzamide::CHEMBL280903 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus >200 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050353 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050353&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10530025 103947540 CHEMBL280903 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045920 CCCCCCCCCCC1(CCCC1)C(=O)Nc1c2OC(C)(C)Cc2ccc1C InChI=1S/C27H43NO2/c1-5-6-7-8-9-10-11-12-17-27(18-13-14-19-27)25(29)28-23-21(2)15-16-22-20-26(3,4)30-24(22)23/h15-16H,5-14,17-20H2,1-4H3,(H,28,29) PNUYJSCEMRPUDP-UHFFFAOYSA-N 50050357 1-Decyl-cyclopentanecarboxylic acid (2,2,6-trimethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL22963 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 240 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050357 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050357&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10501898 103947544 CHEMBL22963 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045922 Cc1cc(C)c(NC(=O)C(C)(C)CCCCCCOc2ccc(Cl)cc2)c2OC(C)(C)Cc12 InChI=1S/C28H38ClNO3/c1-19-17-20(2)24(25-23(19)18-28(5,6)33-25)30-26(31)27(3,4)15-9-7-8-10-16-32-22-13-11-21(29)12-14-22/h11-14,17H,7-10,15-16,18H2,1-6H3,(H,30,31) MHUPDCJBNGBZEU-UHFFFAOYSA-N 50050363 8-(4-Chloro-phenoxy)-2,2-dimethyl-octanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23857 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 76 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050363 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050363&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10648105 103947550 CHEMBL23857 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045923 CCCCCCCCCCCCCCCC(=O)Nc1c2OC(C)(C)Cc2c(C)cc1C InChI=1S/C28H47NO2/c1-6-7-8-9-10-11-12-13-14-15-16-17-18-19-25(30)29-26-23(3)20-22(2)24-21-28(4,5)31-27(24)26/h20H,6-19,21H2,1-5H3,(H,29,30) DGMOMLPUBNBRCQ-UHFFFAOYSA-N 50050381 Hexadecanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL25662 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 26 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050381 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050381&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10526605 103947568 CHEMBL25662 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045924 Cc1cc(C)c(NC(=O)C(C)(C)CCCCCOc2ccc(Cl)cc2)c2OC(C)(C)Cc12 InChI=1S/C27H36ClNO3/c1-18-16-19(2)23(24-22(18)17-27(5,6)32-24)29-25(30)26(3,4)14-8-7-9-15-31-21-12-10-20(28)11-13-21/h10-13,16H,7-9,14-15,17H2,1-6H3,(H,29,30) ILOQZZKQGSBSPD-UHFFFAOYSA-N 50050361 7-(4-Chloro-phenoxy)-2,2-dimethyl-heptanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL553566 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 150 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050361 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050361&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10623731 103947548 CHEMBL553566 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045925 Cc1cc(C)c(NC(=O)C(C)(C)CCCCCc2ccccc2)c2OC(C)(C)Cc12 InChI=1S/C27H37NO2/c1-19-17-20(2)23(24-22(19)18-27(5,6)30-24)28-25(29)26(3,4)16-12-8-11-15-21-13-9-7-10-14-21/h7,9-10,13-14,17H,8,11-12,15-16,18H2,1-6H3,(H,28,29) HFRZOWCQBAGHHC-UHFFFAOYSA-N 50050359 2,2-Dimethyl-7-phenyl-heptanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL25387 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 120 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050359 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050359&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10740176 103947546 CHEMBL25387 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045926 Cc1ccc(OCCCCCCC(C)(C)C(=O)Nc2c3OC(C)(C)Cc3c(C)cc2C)cc1 InChI=1S/C29H41NO3/c1-20-12-14-23(15-13-20)32-17-11-9-8-10-16-28(4,5)27(31)30-25-22(3)18-21(2)24-19-29(6,7)33-26(24)25/h12-15,18H,8-11,16-17,19H2,1-7H3,(H,30,31) NWMVWWHAPPQSFX-UHFFFAOYSA-N 50050366 2,2-Dimethyl-8-p-tolyloxy-octanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL283332 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 50 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050366 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050366&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10551575 103947553 CHEMBL283332 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045927 CCCCCCCCOc1ccc(cc1)C(=O)Nc1c2OC(C)(C)Cc2c(C)cc1C InChI=1S/C27H37NO3/c1-6-7-8-9-10-11-16-30-22-14-12-21(13-15-22)26(29)28-24-20(3)17-19(2)23-18-27(4,5)31-25(23)24/h12-15,17H,6-11,16,18H2,1-5H3,(H,28,29) WNRXYVCDIXHPQR-UHFFFAOYSA-N 50050350 4-Octyloxy-N-(2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-benzamide::CHEMBL422222 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus >200 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050350 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050350&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10740972 103947537 CHEMBL422222 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045928 CCCCCCCCCCC1(CCCC1)C(=O)Nc1c2OC(C)(C)Cc2c(C)c(Cl)c1C InChI=1S/C28H44ClNO2/c1-6-7-8-9-10-11-12-13-16-28(17-14-15-18-28)26(31)30-24-21(3)23(29)20(2)22-19-27(4,5)32-25(22)24/h6-19H2,1-5H3,(H,30,31) XHIPMDNGQJTSOZ-UHFFFAOYSA-N 50050368 1-Decyl-cyclopentanecarboxylic acid (5-chloro-2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23111 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 290 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050368 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050368&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 11798254 103947555 CHEMBL23111 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045929 Cc1cc(C)c(NC(=O)C(C)(C)CCCOc2ccc(Cl)cc2)c2OC(C)(C)Cc12 InChI=1S/C25H32ClNO3/c1-16-14-17(2)21(22-20(16)15-25(5,6)30-22)27-23(28)24(3,4)12-7-13-29-19-10-8-18(26)9-11-19/h8-11,14H,7,12-13,15H2,1-6H3,(H,27,28) FYXLVCUUWHWWMW-UHFFFAOYSA-N 50050373 5-(4-Chloro-phenoxy)-2,2-dimethyl-pentanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL278155 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 260 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050373 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050373&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10836366 103947560 CHEMBL278155 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045930 Cc1cc(C)c(NC(=O)C(C)(C)CCCCCCc2ccccc2)c2OC(C)(C)Cc12 InChI=1S/C28H39NO2/c1-20-18-21(2)24(25-23(20)19-28(5,6)31-25)29-26(30)27(3,4)17-13-8-7-10-14-22-15-11-9-12-16-22/h9,11-12,15-16,18H,7-8,10,13-14,17,19H2,1-6H3,(H,29,30) PTXQWOSUGSOBMP-UHFFFAOYSA-N 50050374 2,2-Dimethyl-8-phenyl-octanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL423651 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 81 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050374 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050374&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10812140 103947561 CHEMBL423651 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045931 CC(C)Cc1ccc(CCCC(C)(C)C(=O)Nc2c3OC(C)(C)Cc3c(C)cc2C)cc1 InChI=1S/C29H41NO2/c1-19(2)16-23-13-11-22(12-14-23)10-9-15-28(5,6)27(31)30-25-21(4)17-20(3)24-18-29(7,8)32-26(24)25/h11-14,17,19H,9-10,15-16,18H2,1-8H3,(H,30,31) FEUKTXQHHIGMGQ-UHFFFAOYSA-N 50050365 5-(4-Isobutyl-phenyl)-2,2-dimethyl-pentanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL424404 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 40 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050365 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050365&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10765355 103947552 CHEMBL424404 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045932 Cc1cc(C)c(NC(=O)C(C)(C)CCCCc2ccccc2)c2OC(C)(C)Cc12 InChI=1S/C26H35NO2/c1-18-16-19(2)22(23-21(18)17-26(5,6)29-23)27-24(28)25(3,4)15-11-10-14-20-12-8-7-9-13-20/h7-9,12-13,16H,10-11,14-15,17H2,1-6H3,(H,27,28) NWJCOQRMTAOTOX-UHFFFAOYSA-N 50050377 2,2-Dimethyl-6-phenyl-hexanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL278578 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 210 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050377 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050377&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10620606 103947564 CHEMBL278578 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045933 CCCCCCCCCCCCCCCC(=O)Nc1cccc2CC(C)(C)Oc12 InChI=1S/C26H43NO2/c1-4-5-6-7-8-9-10-11-12-13-14-15-16-20-24(28)27-23-19-17-18-22-21-26(2,3)29-25(22)23/h17-19H,4-16,20-21H2,1-3H3,(H,27,28) QXIULNHFGSGIHD-UHFFFAOYSA-N 50050351 Hexadecanoic acid (2,2-dimethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23561 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 890 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050351 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050351&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10834917 103947538 CHEMBL23561 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045934 CCCCCCCCCCCCC(C)(C)C(=O)Nc1c2OC(C)(C)Cc2c(C)cc1C InChI=1S/C28H47NO2/c1-8-9-10-11-12-13-14-15-16-17-18-27(4,5)26(30)29-24-22(3)19-21(2)23-20-28(6,7)31-25(23)24/h19H,8-18,20H2,1-7H3,(H,29,30) QZADXWOGWYMHCN-UHFFFAOYSA-N 50050372 2,2-Dimethyl-tetradecanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL281777 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 33 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050372 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050372&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10598699 103947559 CHEMBL281777 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045936 CCCCCCCCC(C)(C)C(=O)Nc1c2OC(C)(C)Cc2c(C)cc1C InChI=1S/C24H39NO2/c1-8-9-10-11-12-13-14-23(4,5)22(26)25-20-18(3)15-17(2)19-16-24(6,7)27-21(19)20/h15H,8-14,16H2,1-7H3,(H,25,26) BVAIDKNIRGVTOY-UHFFFAOYSA-N 50050379 2,2-Dimethyl-decanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL25712 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 140 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050379 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050379&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10809383 103947566 CHEMBL25712 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045937 CCCCCCCCCCC(C)(C)C(=O)Nc1c2OC(C)(C)Cc2c(C)c(N(C)C)c1C InChI=1S/C28H48N2O2/c1-10-11-12-13-14-15-16-17-18-27(4,5)26(31)29-23-21(3)24(30(8)9)20(2)22-19-28(6,7)32-25(22)23/h10-19H2,1-9H3,(H,29,31) QQVVVKMUKKGGQC-UHFFFAOYSA-N 50050356 2,2-Dimethyl-dodecanoic acid (5-dimethylamino-2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23602 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 20 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050356 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050356&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 9889692 103947543 CHEMBL23602 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045962 Cc1cc(C)c(NC(=O)C(C)(C)CCCCOc2ccc(Cl)cc2)c2OC(C)(C)Cc12 InChI=1S/C26H34ClNO3/c1-17-15-18(2)22(23-21(17)16-26(5,6)31-23)28-24(29)25(3,4)13-7-8-14-30-20-11-9-19(27)10-12-20/h9-12,15H,7-8,13-14,16H2,1-6H3,(H,28,29) UDMBQDWSUIGFFF-UHFFFAOYSA-N 50050360 6-(4-Chloro-phenoxy)-2,2-dimethyl-hexanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23599 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 330 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050360 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050360&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10741913 103947547 CHEMBL23599 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045985 CCCCCCCCCCC(C)(C)C(=O)Nc1c2OC(C)(C)Cc2c(C)c(N)c1C InChI=1S/C26H44N2O2/c1-8-9-10-11-12-13-14-15-16-25(4,5)24(29)28-22-19(3)21(27)18(2)20-17-26(6,7)30-23(20)22/h8-17,27H2,1-7H3,(H,28,29) TWXRBDOKQGWRLE-UHFFFAOYSA-N 50050375 2,2-Dimethyl-dodecanoic acid (5-amino-2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL282451 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 59 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050375 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050375&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10811859 103947562 CHEMBL282451 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045986 Cc1cc(C)c(NC(=O)C(C)(C)CCCCOCc2ccccc2)c2OC(C)(C)Cc12 InChI=1S/C27H37NO3/c1-19-16-20(2)23(24-22(19)17-27(5,6)31-24)28-25(29)26(3,4)14-10-11-15-30-18-21-12-8-7-9-13-21/h7-9,12-13,16H,10-11,14-15,17-18H2,1-6H3,(H,28,29) ORBPNJFIWAPTMG-UHFFFAOYSA-N 50050370 6-Benzyloxy-2,2-dimethyl-hexanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL282071 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 400 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050370 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050370&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10788419 103947557 CHEMBL282071 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045987 CCCCCCCCCCC(C)(C)C(=O)Nc1c2OC(C)(C)Cc2c(C)cc1C InChI=1S/C26H43NO2/c1-8-9-10-11-12-13-14-15-16-25(4,5)24(28)27-22-20(3)17-19(2)21-18-26(6,7)29-23(21)22/h17H,8-16,18H2,1-7H3,(H,27,28) DPUQIADAQIHYQU-UHFFFAOYSA-N 50050380 2,2-Dimethyl-dodecanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23976 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 42 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050380 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050380&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10573139 103947567 CHEMBL23976 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045988 Cc1cc(C)c(NC(=O)C(C)(C)CCCCCCN2CCCCC2)c2OC(C)(C)Cc12 InChI=1S/C27H44N2O2/c1-20-18-21(2)23(24-22(20)19-27(5,6)31-24)28-25(30)26(3,4)14-10-7-8-11-15-29-16-12-9-13-17-29/h18H,7-17,19H2,1-6H3,(H,28,30) ONCMLZSYEBMPOM-UHFFFAOYSA-N 50050354 2,2-Dimethyl-8-piperidin-1-yl-octanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23782 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus >500 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050354 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050354&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10741210 103947541 CHEMBL23782 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50045989 Cc1cc(C)c(NC(=O)C(C)(C)CCCCCOc2ccccc2)c2OC(C)(C)Cc12 InChI=1S/C27H37NO3/c1-19-17-20(2)23(24-22(19)18-27(5,6)31-24)28-25(29)26(3,4)15-11-8-12-16-30-21-13-9-7-10-14-21/h7,9-10,13-14,17H,8,11-12,15-16,18H2,1-6H3,(H,28,29) UXWPRBPBGZMQRR-UHFFFAOYSA-N 50050371 2,2-Dimethyl-7-phenoxy-heptanoic acid (2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23340 Acyl-CoA:cholesterol acyltransferase Oryctolagus cuniculus 86 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050371 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000059&target=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050371&enzyme=Acyl-CoA%3Acholesterol+acyltransferase&column=ki&startPg=0&Increment=50&submit=Search 10598390 103947558 CHEMBL23340 1 PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIFVARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLPTVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYIVLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCIF Sterol O-acyltransferase 1 Q95214_RABIT Q95214 50081760 CCCCCCCCCCC(C)(C)C(=O)Nc1c2OC(C)(C)Cc2c(C)c(N(C)C)c1C InChI=1S/C28H48N2O2/c1-10-11-12-13-14-15-16-17-18-27(4,5)26(31)29-23-21(3)24(30(8)9)20(2)22-19-28(6,7)32-25(22)23/h10-19H2,1-9H3,(H,29,31) QQVVVKMUKKGGQC-UHFFFAOYSA-N 50050356 2,2-Dimethyl-dodecanoic acid (5-dimethylamino-2,2,4,6-tetramethyl-2,3-dihydro-benzofuran-7-yl)-amide::CHEMBL23602 Sterol O-acyltransferase 1 Rattus norvegicus 9.0 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050356 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001300&target=Sterol+O-acyltransferase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050356&enzyme=Sterol+O-acyltransferase+1&column=ki&startPg=0&Increment=50&submit=Search 9889692 103947543 CHEMBL23602 1 MVGEETSLRNRLSRSAENPEQDEAQKNLLDTHRNGHITMKQLIAKKRQLAAEAEELKPLFLKEVGCHFDDFVTNLIDKSASLDNGGCALTTFSILEEMKNNHRAKDLRAPPEQGKIFISRRSLLDELFEVDHIRTIYHMFIALLIIFILSTLVVDYIDEGRLVLEFSLLAYAFGQFPIVIWTWWAMFLSTLAIPYFLFQRWAHGYSKSSHPLIYSLIHGAFFLVFQLGILGFIPTYVVLAYTLPPASRFILILEQIRLVMKAHSYVRENVPRVLSAAKEKSSTVPVPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLMLFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYVYKDLLWFFSKRFRPAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGMAFNFIVNDSRKRPVWNIMVRASLFLGHGVILCFYSQEWYARQRCPLKNPTFLDYVRPRTWTCRYVF 6P2P,6P2J,6VUM Sterol O-acyltransferase 1 SOAT1_RAT O70536 50081768 CCCCCCCCCCC(C)(C)C(=O)Nc1c(OC)ccc2C(=O)CCOc12 InChI=1S/C24H37NO4/c1-5-6-7-8-9-10-11-12-16-24(2,3)23(27)25-21-20(28-4)14-13-18-19(26)15-17-29-22(18)21/h13-14H,5-12,15-17H2,1-4H3,(H,25,27) DJBINNZKEHJIFK-UHFFFAOYSA-N 50050362 2,2-Dimethyl-dodecanoic acid (7-methoxy-4-oxo-chroman-8-yl)-amide::CHEMBL278856 Sterol O-acyltransferase 1 Rattus norvegicus 16 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050362 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001300&target=Sterol+O-acyltransferase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050362&enzyme=Sterol+O-acyltransferase+1&column=ki&startPg=0&Increment=50&submit=Search 9953017 103947549 CHEMBL278856 1 MVGEETSLRNRLSRSAENPEQDEAQKNLLDTHRNGHITMKQLIAKKRQLAAEAEELKPLFLKEVGCHFDDFVTNLIDKSASLDNGGCALTTFSILEEMKNNHRAKDLRAPPEQGKIFISRRSLLDELFEVDHIRTIYHMFIALLIIFILSTLVVDYIDEGRLVLEFSLLAYAFGQFPIVIWTWWAMFLSTLAIPYFLFQRWAHGYSKSSHPLIYSLIHGAFFLVFQLGILGFIPTYVVLAYTLPPASRFILILEQIRLVMKAHSYVRENVPRVLSAAKEKSSTVPVPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLMLFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYVYKDLLWFFSKRFRPAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGMAFNFIVNDSRKRPVWNIMVRASLFLGHGVILCFYSQEWYARQRCPLKNPTFLDYVRPRTWTCRYVF 6P2P,6P2J,6VUM Sterol O-acyltransferase 1 SOAT1_RAT O70536 50081775 CCCCCCCCCCC(C)(C)C(=O)Nc1c(cc(cc1OC)OC)OC InChI=1S/C23H39NO4/c1-7-8-9-10-11-12-13-14-15-23(2,3)22(25)24-21-19(27-5)16-18(26-4)17-20(21)28-6/h16-17H,7-15H2,1-6H3,(H,24,25) WAFNZAURAWBNDZ-UHFFFAOYSA-N 50005944 2,2-Dimethyl-dodecanoic acid (2,4,6-trimethoxy-phenyl)-amide::CHEMBL22373::CI-976 Sterol O-acyltransferase 1 Rattus norvegicus 149 ChEMBL 10.1021/jm950828+ 10.7270/Q24T6HGW 8632433 Kataoka, K; Shiota, T; Takeyasu, T; Minoshima, T; Watanabe, K; Tanaka, H; Mochizuki, T; Taneda, K; Ota, M; Tanabe, H; Yamaguchi, H 7/3/1996 11/10/2009 Institute For Bio-Medical Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50005944 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001300&target=Sterol+O-acyltransferase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50005944&enzyme=Sterol+O-acyltransferase+1&column=ki&startPg=0&Increment=50&submit=Search E5L 6L47 122327 103919368 CHEMBL22373 1 MVGEETSLRNRLSRSAENPEQDEAQKNLLDTHRNGHITMKQLIAKKRQLAAEAEELKPLFLKEVGCHFDDFVTNLIDKSASLDNGGCALTTFSILEEMKNNHRAKDLRAPPEQGKIFISRRSLLDELFEVDHIRTIYHMFIALLIIFILSTLVVDYIDEGRLVLEFSLLAYAFGQFPIVIWTWWAMFLSTLAIPYFLFQRWAHGYSKSSHPLIYSLIHGAFFLVFQLGILGFIPTYVVLAYTLPPASRFILILEQIRLVMKAHSYVRENVPRVLSAAKEKSSTVPVPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLMLFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYVYKDLLWFFSKRFRPAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGMAFNFIVNDSRKRPVWNIMVRASLFLGHGVILCFYSQEWYARQRCPLKNPTFLDYVRPRTWTCRYVF 6P2P,6P2J,6VUM Sterol O-acyltransferase 1 SOAT1_RAT O70536