BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50081358	CC(C)C[C@H](N(C)C(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C30H41N5O5/c1-18(2)15-25(35(5)30(39)31-21-11-7-6-8-12-21)27(36)32-23(28-33-26(29(37)38)19(3)40-28)16-20-17-34(4)24-14-10-9-13-22(20)24/h9-10,13-14,17-18,21,23,25H,6-8,11-12,15-16H2,1-5H3,(H,31,39)(H,32,36)(H,37,38)	VKVUQJMVRPZBIO-UHFFFAOYSA-N	50050052	2-[(R)-1-[(S)-2-(3-Cyclohexyl-1-methyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL369821	Endothelin receptor type B	Homo sapiens		>100000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050052	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050052&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10650331	103947257		CHEMBL369821					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081359	CC(C)C[C@H](OC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C29H38N4O6/c1-17(2)14-24(39-29(37)30-20-10-6-5-7-11-20)26(34)31-22(27-32-25(28(35)36)18(3)38-27)15-19-16-33(4)23-13-9-8-12-21(19)23/h8-9,12-13,16-17,20,22,24H,5-7,10-11,14-15H2,1-4H3,(H,30,37)(H,31,34)(H,35,36)	JBRMRKFUAREDQM-UHFFFAOYSA-N	50050051	2-[(R)-1-((S)-2-Cyclohexylcarbamoyloxy-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL177546	Endothelin receptor type B	Homo sapiens		 48000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050051	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050051&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10673969	103947256		CHEMBL177546					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081360	CC(C)C[C@H](NC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C29H39N5O5/c1-17(2)14-22(32-29(38)30-20-10-6-5-7-11-20)26(35)31-23(27-33-25(28(36)37)18(3)39-27)15-19-16-34(4)24-13-9-8-12-21(19)24/h8-9,12-13,16-17,20,22-23H,5-7,10-11,14-15H2,1-4H3,(H,31,35)(H,36,37)(H2,30,32,38)	MAKSAWWTYOIXFZ-UHFFFAOYSA-N	50050042	2-[(R)-1-[(S)-2-(3-Cyclohexyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL441112	Endothelin receptor type B	Homo sapiens		>100000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050042	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050042&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10554384	103947247		CHEMBL441112					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081361	CC(C)C[C@H](NC(=O)CC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C30H40N4O5/c1-18(2)14-23(31-26(35)15-20-10-6-5-7-11-20)28(36)32-24(29-33-27(30(37)38)19(3)39-29)16-21-17-34(4)25-13-9-8-12-22(21)25/h8-9,12-13,17-18,20,23-24H,5-7,10-11,14-16H2,1-4H3,(H,31,35)(H,32,36)(H,37,38)	UAYDAFZHDUZNPZ-UHFFFAOYSA-N	50050053	2-[(R)-1-[(S)-2-(2-Cyclohexyl-acetylamino)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL177179	Endothelin receptor type B	Homo sapiens		>100000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050053	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050053&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10602451	103947258		CHEMBL177179					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081362	CC(C)C[C@H](CC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C30H40N4O5/c1-18(2)14-20(16-26(35)31-22-10-6-5-7-11-22)28(36)32-24(29-33-27(30(37)38)19(3)39-29)15-21-17-34(4)25-13-9-8-12-23(21)25/h8-9,12-13,17-18,20,22,24H,5-7,10-11,14-16H2,1-4H3,(H,31,35)(H,32,36)(H,37,38)	PNMVPOFSIZYXEJ-UHFFFAOYSA-N	50050054	2-[(R)-1-((R)-2-Cyclohexylcarbamoylmethyl-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL177839	Endothelin receptor type B	Homo sapiens		>100000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050054	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050054&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			11800505	103947259		CHEMBL177839					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081363	CC(C)C[C@H](N(C)C(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C30H42N6O4/c1-18(2)15-25(36(5)30(40)32-21-11-7-6-8-12-21)28(37)33-23(27-31-19(3)26(34-27)29(38)39)16-20-17-35(4)24-14-10-9-13-22(20)24/h9-10,13-14,17-18,21,23,25H,6-8,11-12,15-16H2,1-5H3,(H,31,34)(H,32,40)(H,33,37)(H,38,39)	GGGSQHCWNBTLSJ-UHFFFAOYSA-N	50050055	2-[(R)-1-[(S)-2-(3-Cyclohexyl-1-methyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL367033	Endothelin receptor type B	Homo sapiens		>100000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050055	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050055&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10578601	103947260		CHEMBL367033					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081364	CC(C)C[C@H](NC(=O)N(C)C1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C30H42N6O4/c1-18(2)15-24(33-30(40)36(5)21-11-7-6-8-12-21)28(37)32-23(27-31-19(3)26(34-27)29(38)39)16-20-17-35(4)25-14-10-9-13-22(20)25/h9-10,13-14,17-18,21,23-24H,6-8,11-12,15-16H2,1-5H3,(H,31,34)(H,32,37)(H,33,40)(H,38,39)	JUYJVWUMDGZHSF-UHFFFAOYSA-N	50050056	2-[(R)-1-[(S)-2-(3-Cyclohexyl-3-methyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL414605	Endothelin-1 receptor	Homo sapiens		 1.8							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050056	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050056&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			11800804	103947261		CHEMBL414605					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081365	CC(C)C[C@H](NC(=O)CC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C30H41N5O4/c1-18(2)14-24(32-26(36)15-20-10-6-5-7-11-20)29(37)33-23(28-31-19(3)27(34-28)30(38)39)16-21-17-35(4)25-13-9-8-12-22(21)25/h8-9,12-13,17-18,20,23-24H,5-7,10-11,14-16H2,1-4H3,(H,31,34)(H,32,36)(H,33,37)(H,38,39)	WDJALAMRYSCDQD-UHFFFAOYSA-N	50050057	2-[(R)-1-[(S)-2-(2-Cyclohexyl-acetylamino)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL174871	Endothelin receptor type B	Homo sapiens		>90000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050057	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050057&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10626177	103947262		CHEMBL174871					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081366	CC(C)C[C@H](CC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C30H40N4O5/c1-18(2)14-20(16-26(35)31-22-10-6-5-7-11-22)28(36)32-24(29-33-27(30(37)38)19(3)39-29)15-21-17-34(4)25-13-9-8-12-23(21)25/h8-9,12-13,17-18,20,22,24H,5-7,10-11,14-16H2,1-4H3,(H,31,35)(H,32,36)(H,37,38)	PNMVPOFSIZYXEJ-UHFFFAOYSA-N	50050054	2-[(R)-1-((R)-2-Cyclohexylcarbamoylmethyl-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL177839	Endothelin-1 receptor	Homo sapiens		 310							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050054	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050054&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			11800505	103947259		CHEMBL177839					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081367	CC(C)C[C@H](OC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C29H39N5O5/c1-17(2)14-24(39-29(38)31-20-10-6-5-7-11-20)27(35)32-22(26-30-18(3)25(33-26)28(36)37)15-19-16-34(4)23-13-9-8-12-21(19)23/h8-9,12-13,16-17,20,22,24H,5-7,10-11,14-15H2,1-4H3,(H,30,33)(H,31,38)(H,32,35)(H,36,37)	FSHZBEPAMREIHF-UHFFFAOYSA-N	50050058	2-[(R)-1-((S)-2-Cyclohexylcarbamoyloxy-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL175228	Endothelin receptor type B	Homo sapiens		 54000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050058	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050058&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10650062	103947263		CHEMBL175228					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081368	CC(C)C[C@H](N(C)C(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C30H41N5O5/c1-18(2)15-25(35(5)30(39)31-21-11-7-6-8-12-21)27(36)32-23(28-33-26(29(37)38)19(3)40-28)16-20-17-34(4)24-14-10-9-13-22(20)24/h9-10,13-14,17-18,21,23,25H,6-8,11-12,15-16H2,1-5H3,(H,31,39)(H,32,36)(H,37,38)	VKVUQJMVRPZBIO-UHFFFAOYSA-N	50050052	2-[(R)-1-[(S)-2-(3-Cyclohexyl-1-methyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL369821	Endothelin-1 receptor	Homo sapiens		 450							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050052	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050052&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10650331	103947257		CHEMBL369821					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081369	CC(C)C[C@H](NC(=O)N(C)C1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C30H41N5O5/c1-18(2)15-23(32-30(39)35(5)21-11-7-6-8-12-21)27(36)31-24(28-33-26(29(37)38)19(3)40-28)16-20-17-34(4)25-14-10-9-13-22(20)25/h9-10,13-14,17-18,21,23-24H,6-8,11-12,15-16H2,1-5H3,(H,31,36)(H,32,39)(H,37,38)	CYNRTRAOTKDFNE-UHFFFAOYSA-N	50050059	2-[(R)-1-[(S)-2-(3-Cyclohexyl-3-methyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL174699	Endothelin-1 receptor	Homo sapiens		 25							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050059	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050059&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10792783	103947264		CHEMBL174699					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081370	CC(C)C[C@H](NC(=O)OC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C29H38N4O6/c1-17(2)14-22(31-29(37)39-20-10-6-5-7-11-20)26(34)30-23(27-32-25(28(35)36)18(3)38-27)15-19-16-33(4)24-13-9-8-12-21(19)24/h8-9,12-13,16-17,20,22-23H,5-7,10-11,14-15H2,1-4H3,(H,30,34)(H,31,37)(H,35,36)	NVCMJDTXNXADGH-UHFFFAOYSA-N	50050060	2-[(R)-1-((S)-2-Cyclohexyloxycarbonylamino-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL353320	Endothelin-1 receptor	Homo sapiens		 41							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050060	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050060&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10554410	103947265		CHEMBL353320					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081371	CC(C)C[C@H](NC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C29H39N5O5/c1-17(2)14-22(32-29(38)30-20-10-6-5-7-11-20)26(35)31-23(27-33-25(28(36)37)18(3)39-27)15-19-16-34(4)24-13-9-8-12-21(19)24/h8-9,12-13,16-17,20,22-23H,5-7,10-11,14-15H2,1-4H3,(H,31,35)(H,36,37)(H2,30,32,38)	MAKSAWWTYOIXFZ-UHFFFAOYSA-N	50050042	2-[(R)-1-[(S)-2-(3-Cyclohexyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL441112	Endothelin-1 receptor	Homo sapiens		 220							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050042	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050042&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10554384	103947247		CHEMBL441112					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081372	CC(C)C[C@H](CC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C30H41N5O4/c1-18(2)14-20(16-26(36)32-22-10-6-5-7-11-22)29(37)33-24(28-31-19(3)27(34-28)30(38)39)15-21-17-35(4)25-13-9-8-12-23(21)25/h8-9,12-13,17-18,20,22,24H,5-7,10-11,14-16H2,1-4H3,(H,31,34)(H,32,36)(H,33,37)(H,38,39)	VWBNQTBYAHOFDQ-UHFFFAOYSA-N	50050061	2-[(R)-1-((R)-2-Cyclohexylcarbamoylmethyl-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL366805	Endothelin-1 receptor	Homo sapiens		 29							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050061	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050061&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10506505	103947266		CHEMBL366805					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081373	CC(C)C[C@H](NC(=O)CC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C30H40N4O5/c1-18(2)14-23(31-26(35)15-20-10-6-5-7-11-20)28(36)32-24(29-33-27(30(37)38)19(3)39-29)16-21-17-34(4)25-13-9-8-12-22(21)25/h8-9,12-13,17-18,20,23-24H,5-7,10-11,14-16H2,1-4H3,(H,31,35)(H,32,36)(H,37,38)	UAYDAFZHDUZNPZ-UHFFFAOYSA-N	50050053	2-[(R)-1-[(S)-2-(2-Cyclohexyl-acetylamino)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL177179	Endothelin-1 receptor	Homo sapiens		 680.0							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050053	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050053&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10602451	103947258		CHEMBL177179					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081374	CC(C)C[C@H](OC(=O)N(C)C1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C30H40N4O6/c1-18(2)15-25(40-30(38)34(5)21-11-7-6-8-12-21)27(35)31-23(28-32-26(29(36)37)19(3)39-28)16-20-17-33(4)24-14-10-9-13-22(20)24/h9-10,13-14,17-18,21,23,25H,6-8,11-12,15-16H2,1-5H3,(H,31,35)(H,36,37)	VFJNRIMZXJQZIA-UHFFFAOYSA-N	50050063	2-[(R)-1-[(S)-2-(Cyclohexyl-methyl-carbamoyloxy)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL175698	Endothelin-1 receptor	Homo sapiens		 4.6							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050063	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050063&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			9959298	103947268		CHEMBL175698					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081375	CC(C)C[C@H](NC(=O)OC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C29H39N5O5/c1-17(2)14-23(32-29(38)39-20-10-6-5-7-11-20)27(35)31-22(26-30-18(3)25(33-26)28(36)37)15-19-16-34(4)24-13-9-8-12-21(19)24/h8-9,12-13,16-17,20,22-23H,5-7,10-11,14-15H2,1-4H3,(H,30,33)(H,31,35)(H,32,38)(H,36,37)	QUJDRPRAFGCPRB-UHFFFAOYSA-N	50050062	2-[(R)-1-((S)-2-Cyclohexyloxycarbonylamino-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL367645	Endothelin-1 receptor	Homo sapiens		 76							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050062	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050062&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10578300	103947267		CHEMBL367645					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081376	CC(C)C[C@H](OC(=O)OC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C29H37N3O7/c1-17(2)14-24(39-29(36)38-20-10-6-5-7-11-20)26(33)30-22(27-31-25(28(34)35)18(3)37-27)15-19-16-32(4)23-13-9-8-12-21(19)23/h8-9,12-13,16-17,20,22,24H,5-7,10-11,14-15H2,1-4H3,(H,30,33)(H,34,35)	PYCASCCEVIFVMW-UHFFFAOYSA-N	50050064	2-[(R)-1-((S)-2-Cyclohexyloxycarbonyloxy-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL368629	Endothelin receptor type B	Homo sapiens		 79000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050064	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050064&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10626245	103947269		CHEMBL368629					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081377	CC(C)C[C@H](OC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C29H38N4O6/c1-17(2)14-24(39-29(37)30-20-10-6-5-7-11-20)26(34)31-22(27-32-25(28(35)36)18(3)38-27)15-19-16-33(4)23-13-9-8-12-21(19)23/h8-9,12-13,16-17,20,22,24H,5-7,10-11,14-15H2,1-4H3,(H,30,37)(H,31,34)(H,35,36)	JBRMRKFUAREDQM-UHFFFAOYSA-N	50050051	2-[(R)-1-((S)-2-Cyclohexylcarbamoyloxy-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL177546	Endothelin-1 receptor	Homo sapiens		 21							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050051	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050051&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10673969	103947256		CHEMBL177546					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081378	CC(C)C[C@H](NC(=O)N(C)C1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C30H41N5O5/c1-18(2)15-23(32-30(39)35(5)21-11-7-6-8-12-21)27(36)31-24(28-33-26(29(37)38)19(3)40-28)16-20-17-34(4)25-14-10-9-13-22(20)25/h9-10,13-14,17-18,21,23-24H,6-8,11-12,15-16H2,1-5H3,(H,31,36)(H,32,39)(H,37,38)	CYNRTRAOTKDFNE-UHFFFAOYSA-N	50050059	2-[(R)-1-[(S)-2-(3-Cyclohexyl-3-methyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL174699	Endothelin receptor type B	Homo sapiens		>100000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050059	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050059&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10792783	103947264		CHEMBL174699					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081379	CC(C)C[C@H](NC(=O)N(C)C1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C30H42N6O4/c1-18(2)15-24(33-30(40)36(5)21-11-7-6-8-12-21)28(37)32-23(27-31-19(3)26(34-27)29(38)39)16-20-17-35(4)25-14-10-9-13-22(20)25/h9-10,13-14,17-18,21,23-24H,6-8,11-12,15-16H2,1-5H3,(H,31,34)(H,32,37)(H,33,40)(H,38,39)	JUYJVWUMDGZHSF-UHFFFAOYSA-N	50050056	2-[(R)-1-[(S)-2-(3-Cyclohexyl-3-methyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL414605	Endothelin receptor type B	Homo sapiens		 20000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050056	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050056&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			11800804	103947261		CHEMBL414605					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081380	CC(C)C[C@H](OC(=O)N(C)C1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C30H40N4O6/c1-18(2)15-25(40-30(38)34(5)21-11-7-6-8-12-21)27(35)31-23(28-32-26(29(36)37)19(3)39-28)16-20-17-33(4)24-14-10-9-13-22(20)24/h9-10,13-14,17-18,21,23,25H,6-8,11-12,15-16H2,1-5H3,(H,31,35)(H,36,37)	VFJNRIMZXJQZIA-UHFFFAOYSA-N	50050063	2-[(R)-1-[(S)-2-(Cyclohexyl-methyl-carbamoyloxy)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL175698	Endothelin receptor type B	Homo sapiens		 90000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050063	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050063&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			9959298	103947268		CHEMBL175698					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081381	CC(C)C[C@H](NC(=O)OC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C29H38N4O6/c1-17(2)14-22(31-29(37)39-20-10-6-5-7-11-20)26(34)30-23(27-32-25(28(35)36)18(3)38-27)15-19-16-33(4)24-13-9-8-12-21(19)24/h8-9,12-13,16-17,20,22-23H,5-7,10-11,14-15H2,1-4H3,(H,30,34)(H,31,37)(H,35,36)	NVCMJDTXNXADGH-UHFFFAOYSA-N	50050060	2-[(R)-1-((S)-2-Cyclohexyloxycarbonylamino-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL353320	Endothelin receptor type B	Homo sapiens		>100000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050060	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050060&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10554410	103947265		CHEMBL353320					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081382	CC(C)C[C@H](NC(=O)OC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C29H39N5O5/c1-17(2)14-23(32-29(38)39-20-10-6-5-7-11-20)27(35)31-22(26-30-18(3)25(33-26)28(36)37)15-19-16-34(4)24-13-9-8-12-21(19)24/h8-9,12-13,16-17,20,22-23H,5-7,10-11,14-15H2,1-4H3,(H,30,33)(H,31,35)(H,32,38)(H,36,37)	QUJDRPRAFGCPRB-UHFFFAOYSA-N	50050062	2-[(R)-1-((S)-2-Cyclohexyloxycarbonylamino-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL367645	Endothelin receptor type B	Homo sapiens		>100000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050062	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050062&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10578300	103947267		CHEMBL367645					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081383	CC(C)C[C@H](N(C)C(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C30H42N6O4/c1-18(2)15-25(36(5)30(40)32-21-11-7-6-8-12-21)28(37)33-23(27-31-19(3)26(34-27)29(38)39)16-20-17-35(4)24-14-10-9-13-22(20)24/h9-10,13-14,17-18,21,23,25H,6-8,11-12,15-16H2,1-5H3,(H,31,34)(H,32,40)(H,33,37)(H,38,39)	GGGSQHCWNBTLSJ-UHFFFAOYSA-N	50050055	2-[(R)-1-[(S)-2-(3-Cyclohexyl-1-methyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL367033	Endothelin-1 receptor	Homo sapiens		 22							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050055	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050055&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10578601	103947260		CHEMBL367033					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081384	CC(C)C[C@H](NC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C29H40N6O4/c1-17(2)14-23(33-29(39)31-20-10-6-5-7-11-20)27(36)32-22(26-30-18(3)25(34-26)28(37)38)15-19-16-35(4)24-13-9-8-12-21(19)24/h8-9,12-13,16-17,20,22-23H,5-7,10-11,14-15H2,1-4H3,(H,30,34)(H,32,36)(H,37,38)(H2,31,33,39)	QGQSORGTKDCUOS-UHFFFAOYSA-N	50050047	2-[(R)-1-[(S)-2-(3-Cyclohexyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL174448	Endothelin-1 receptor	Homo sapiens		 11							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050047	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050047&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10697633	103947252		CHEMBL174448					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081385	CC(C)C[C@H](OC(=O)OC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)o1	InChI=1S/C29H37N3O7/c1-17(2)14-24(39-29(36)38-20-10-6-5-7-11-20)26(33)30-22(27-31-25(28(34)35)18(3)37-27)15-19-16-32(4)23-13-9-8-12-21(19)23/h8-9,12-13,16-17,20,22,24H,5-7,10-11,14-15H2,1-4H3,(H,30,33)(H,34,35)	PYCASCCEVIFVMW-UHFFFAOYSA-N	50050064	2-[(R)-1-((S)-2-Cyclohexyloxycarbonyloxy-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-oxazole-4-carboxylic acid::CHEMBL368629	Endothelin-1 receptor	Homo sapiens		 17							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050064	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050064&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10626245	103947269		CHEMBL368629					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081386	CC(C)C[C@H](OC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C29H39N5O5/c1-17(2)14-24(39-29(38)31-20-10-6-5-7-11-20)27(35)32-22(26-30-18(3)25(33-26)28(36)37)15-19-16-34(4)23-13-9-8-12-21(19)23/h8-9,12-13,16-17,20,22,24H,5-7,10-11,14-15H2,1-4H3,(H,30,33)(H,31,38)(H,32,35)(H,36,37)	FSHZBEPAMREIHF-UHFFFAOYSA-N	50050058	2-[(R)-1-((S)-2-Cyclohexylcarbamoyloxy-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL175228	Endothelin-1 receptor	Homo sapiens		 9.3							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050058	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050058&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10650062	103947263		CHEMBL175228					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081387	CC(C)C[C@H](CC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C30H41N5O4/c1-18(2)14-20(16-26(36)32-22-10-6-5-7-11-22)29(37)33-24(28-31-19(3)27(34-28)30(38)39)15-21-17-35(4)25-13-9-8-12-23(21)25/h8-9,12-13,17-18,20,22,24H,5-7,10-11,14-16H2,1-4H3,(H,31,34)(H,32,36)(H,33,37)(H,38,39)	VWBNQTBYAHOFDQ-UHFFFAOYSA-N	50050061	2-[(R)-1-((R)-2-Cyclohexylcarbamoylmethyl-4-methyl-pentanoylamino)-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL366805	Endothelin receptor type B	Homo sapiens		>100000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050061	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050061&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10506505	103947266		CHEMBL366805					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081388	CC(C)C[C@H](NC(=O)CC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C30H41N5O4/c1-18(2)14-24(32-26(36)15-20-10-6-5-7-11-20)29(37)33-23(28-31-19(3)27(34-28)30(38)39)16-21-17-35(4)25-13-9-8-12-22(21)25/h8-9,12-13,17-18,20,23-24H,5-7,10-11,14-16H2,1-4H3,(H,31,34)(H,32,36)(H,33,37)(H,38,39)	WDJALAMRYSCDQD-UHFFFAOYSA-N	50050057	2-[(R)-1-[(S)-2-(2-Cyclohexyl-acetylamino)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL174871	Endothelin-1 receptor	Homo sapiens		 470							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050057	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000502&target=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050057&enzyme=Endothelin-1+receptor&column=ki&startPg=0&Increment=50&submit=Search			10626177	103947262		CHEMBL174871					1	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN	8HCQ,8XVL,8XVK,8XVJ	Endothelin-1 receptor	EDNRA_HUMAN	P25101	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50081389	CC(C)C[C@H](NC(=O)NC1CCCCC1)C(=O)N[C@H](Cc1cn(C)c2ccccc12)c1nc(C(O)=O)c(C)[nH]1	InChI=1S/C29H40N6O4/c1-17(2)14-23(33-29(39)31-20-10-6-5-7-11-20)27(36)32-22(26-30-18(3)25(34-26)28(37)38)15-19-16-35(4)24-13-9-8-12-21(19)24/h8-9,12-13,16-17,20,22-23H,5-7,10-11,14-15H2,1-4H3,(H,30,34)(H,32,36)(H,37,38)(H2,31,33,39)	QGQSORGTKDCUOS-UHFFFAOYSA-N	50050047	2-[(R)-1-[(S)-2-(3-Cyclohexyl-ureido)-4-methyl-pentanoylamino]-2-(1-methyl-1H-indol-3-yl)-ethyl]-5-methyl-1H-imidazole-4-carboxylic acid::CHEMBL174448	Endothelin receptor type B	Homo sapiens		 34000							ChEMBL	10.1021/jm9505932	10.7270/Q2DB80WG	8632421			von Geldern, TW; Hoffman, DJ; Kester, JA; Nellans, HN; Dayton, BD; Calzadilla, SV; Marsh, KC; Hernandez, L; Chiou, W; Dixon, DB; Wu-Wong, JR; Opgenorth, TJ	6/28/1996	11/10/2009	Abbott Laboratories	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50050047	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000505&target=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50050047&enzyme=Endothelin+receptor+type+B&column=ki&startPg=0&Increment=50&submit=Search			10697633	103947252		CHEMBL174448					1	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS	8HCX,8HBD,8XVH,8XVE,9KDG,9KDF	Endothelin receptor type B	EDNRB_HUMAN	P24530	A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
