BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50079204	CCOC(=O)CCCn1c(=O)n(C2CCOC2)c2nccnc2c1=O	InChI=1S/C16H20N4O5/c1-2-25-12(21)4-3-8-19-15(22)13-14(18-7-6-17-13)20(16(19)23)11-5-9-24-10-11/h6-7,11H,2-5,8-10H2,1H3	CRKJZDNGLGKHJW-UHFFFAOYSA-N	50048920	4-[2,4-Dioxo-1-(tetrahydro-furan-3-yl)-1,4-dihydro-2H-pteridin-3-yl]-butyric acid ethyl ester::CHEMBL355042	Tumor necrosis factor	Homo sapiens		 19000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048920	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048920&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			44383341	103979301		CHEMBL355042					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079205	CCOC(=O)CCCn1c(=O)n(C)c2nc(Br)n(C)c2c1=O	InChI=1S/C13H17BrN4O4/c1-4-22-8(19)6-5-7-18-11(20)9-10(17(3)13(18)21)15-12(14)16(9)2/h4-7H2,1-3H3	ASAWECPKYMYCLO-UHFFFAOYSA-N	50048921	4-(8-Bromo-3,7-dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-purin-1-yl)-butyric acid ethyl ester::CHEMBL169795	Tumor necrosis factor	Homo sapiens		 60000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048921	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048921&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10595485	103979302		CHEMBL169795					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079206	CCOC(=O)CCCn1c(=O)n(C)c2nc(CC)c(CC)nc2c1=O	InChI=1S/C17H24N4O4/c1-5-11-12(6-2)19-15-14(18-11)16(23)21(17(24)20(15)4)10-8-9-13(22)25-7-3/h5-10H2,1-4H3	XYAAUTJXSPAZMH-UHFFFAOYSA-N	50048922	4-(6,7-Diethyl-1-methyl-2,4-dioxo-1,4-dihydro-2H-pteridin-3-yl)-butyric acid ethyl ester::CHEMBL171272	Tumor necrosis factor	Homo sapiens		 130000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048922	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048922&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10831577	103979303		CHEMBL171272					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079207	COc1ccc(cc1OC2CCCC2)[C@H]3CC(=O)NC3	InChI=1S/C16H21NO3/c1-19-14-7-6-11(12-9-16(18)17-10-12)8-15(14)20-13-4-2-3-5-13/h6-8,12-13H,2-5,9-10H2,1H3,(H,17,18)	HJORMJIFDVBMOB-UHFFFAOYSA-N	14361	Adeo::4-(3-cyclopentyloxy-4-methoxy-phenyl)pyrrolidin-2-one::(R,S)-Rolipram::4-[3-(cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one::CHEMBL63::Rolipram	Tumor necrosis factor	Homo sapiens		 12000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=14361	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=14361&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	ROL	1OYN,1Q9M,1RO6,1TBB,1XMY,1XN0,3G4K,4X0F,5OH8	5092	46514702		CHEMBL63					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079208	Cn1c2ccccc2c(=O)n(CCCC(O)=O)c1=O	InChI=1S/C13H14N2O4/c1-14-10-6-3-2-5-9(10)12(18)15(13(14)19)8-4-7-11(16)17/h2-3,5-6H,4,7-8H2,1H3,(H,16,17)	WVCNHEJUXRBIMR-UHFFFAOYSA-N	50048923	4-(1-Methyl-2,4-dioxo-1,4-dihydro-2H-quinazolin-3-yl)-butyric acid::CHEMBL368515	Tumor necrosis factor	Homo sapiens		>200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048923	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048923&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10730172	103979304		CHEMBL368515					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079209	CCOC(=O)CCCCn1c(=O)n(C)c2ncn(C)c2c1=O	InChI=1S/C14H20N4O4/c1-4-22-10(19)7-5-6-8-18-13(20)11-12(15-9-16(11)2)17(3)14(18)21/h9H,4-8H2,1-3H3	JYPKBIVPQQYTHP-UHFFFAOYSA-N	50048924	5-(3,7-Dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-purin-1-yl)-pentanoic acid ethyl ester::CHEMBL172669	Tumor necrosis factor	Homo sapiens		 11000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048924	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048924&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10852312	103979305		CHEMBL172669					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079210	CCCCOc1cc(ccc1OC)C[C@@H]2CNC(=O)N2	InChI=1S/C15H22N2O3/c1-3-4-7-20-14-9-11(5-6-13(14)19-2)8-12-10-16-15(18)17-12/h5-6,9,12H,3-4,7-8,10H2,1-2H3,(H2,16,17,18)	PDMUULPVBYQBBK-UHFFFAOYSA-N	50010981	4-(3-Butoxy-4-methoxy-benzyl)-imidazolidin-2-one::CHEMBL18701::Ro-20-1724::RO 20-1724::4-(3-Butyl-4-methoxy-benzyl)-imidazolidin-2-one::(Ro 20-1724)4-(3-Butoxy-4-methoxy-benzyl)-imidazolidin-2-one::4-(3-Butoxy-4-methoxy-benzyl)-imidazolidin-2-one(Ro 20-1724)	Tumor necrosis factor	Homo sapiens		 50000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50010981	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50010981&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			5087	103923704		CHEMBL18701					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079211	CCCCn1c2nccnc2c(=O)n(CCCC(=O)OCC)c1=O	InChI=1S/C16H22N4O4/c1-3-5-10-19-14-13(17-8-9-18-14)15(22)20(16(19)23)11-6-7-12(21)24-4-2/h8-9H,3-7,10-11H2,1-2H3	OEZUVFVPUUBTEN-UHFFFAOYSA-N	50048925	4-(1-Butyl-2,4-dioxo-1,4-dihydro-2H-pteridin-3-yl)-butyric acid ethyl ester::CHEMBL352725	Tumor necrosis factor	Homo sapiens		 15000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048925	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048925&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10520713	103979306		CHEMBL352725					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079212	Cn1c2[nH]c(=S)[nH]c2c(=O)[nH]c1=O	InChI=1S/C6H6N4O2S/c1-10-3-2(7-5(13)8-3)4(11)9-6(10)12/h1H3,(H2,7,8,13)(H,9,11,12)	GVRAFHMHIIIMFZ-UHFFFAOYSA-N	50048926	8-Mercapto-3-methyl-3,7-dihydro-purine-2,6-dione::CHEMBL171452	Tumor necrosis factor	Homo sapiens		>200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048926	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048926&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			3081830	103979307		CHEMBL171452					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079213	CCCn1c2nccnc2c(=O)n(CCCC(=O)OCC)c1=O	InChI=1S/C15H20N4O4/c1-3-9-18-13-12(16-7-8-17-13)14(21)19(15(18)22)10-5-6-11(20)23-4-2/h7-8H,3-6,9-10H2,1-2H3	YHZWAPPISCDOHT-UHFFFAOYSA-N	50048928	4-(2,4-Dioxo-1-propyl-1,4-dihydro-2H-pteridin-3-yl)-butyric acid ethyl ester::CHEMBL127042	Tumor necrosis factor	Homo sapiens		 5000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048928	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048928&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			9948975	103979309		CHEMBL127042					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079214	CCCCCCCn1c(=O)n(C)c2nsnc2c1=O	InChI=1S/C12H18N4O2S/c1-3-4-5-6-7-8-16-11(17)9-10(14-19-13-9)15(2)12(16)18/h3-8H2,1-2H3	UDRIBVJSKTWRAU-UHFFFAOYSA-N	50048927	6-Heptyl-4-methyl-4H-[1,2,5]thiadiazolo[3,4-d]pyrimidine-5,7-dione::CHEMBL174254	Tumor necrosis factor	Homo sapiens		 75000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048927	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048927&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10731615	103979308		CHEMBL174254					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079215	CCCn1c2ncn(C)c2c(=O)n(CCCC(=O)OCC)c1=O	InChI=1S/C15H22N4O4/c1-4-8-18-13-12(17(3)10-16-13)14(21)19(15(18)22)9-6-7-11(20)23-5-2/h10H,4-9H2,1-3H3	WMQTXFIGONDPFP-UHFFFAOYSA-N	50048929	4-(7-Methyl-2,6-dioxo-3-propyl-2,3,6,7-tetrahydro-purin-1-yl)-butyric acid ethyl ester::CHEMBL171989	Tumor necrosis factor	Homo sapiens		 5000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048929	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048929&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10019033	103979310		CHEMBL171989					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079216	COC(=O)c1ccc(Cn2c(=O)n(C)c3nc(Br)n(C)c3c2=O)cc1	InChI=1S/C16H15BrN4O4/c1-19-11-12(18-15(19)17)20(2)16(24)21(13(11)22)8-9-4-6-10(7-5-9)14(23)25-3/h4-7H,8H2,1-3H3	WARHQDDDNLSREK-UHFFFAOYSA-N	50048930	4-(8-Bromo-3,7-dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-purin-1-ylmethyl)-benzoic acid methyl ester::CHEMBL170259	Tumor necrosis factor	Homo sapiens		>200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048930	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048930&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10692755	103979311		CHEMBL170259					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079217	CCOC(=O)CCn1c(=O)n(C)c2ncn(C)c2c1=O	InChI=1S/C12H16N4O4/c1-4-20-8(17)5-6-16-11(18)9-10(13-7-14(9)2)15(3)12(16)19/h7H,4-6H2,1-3H3	VWQAEIOJOMGRIT-UHFFFAOYSA-N	50048931	3-(3,7-Dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-purin-1-yl)-propionic acid ethyl ester::CHEMBL171406	Tumor necrosis factor	Homo sapiens		 10000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048931	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048931&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10660380	103979312		CHEMBL171406					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079218	COC(=O)\C=C/Cn1c(=O)n(C)c2nccnc2c1=O	InChI=1S/C12H12N4O4/c1-15-10-9(13-5-6-14-10)11(18)16(12(15)19)7-3-4-8(17)20-2/h3-6H,7H2,1-2H3	AHVNXOXXHVOJMF-UHFFFAOYSA-N	50048938	(Z)-4-(1-Methyl-2,4-dioxo-1,4-dihydro-2H-pteridin-3-yl)-but-2-enoic acid methyl ester::CHEMBL354257	Tumor necrosis factor	Homo sapiens		 25000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048938	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048938&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			44382351	103979319		CHEMBL354257					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079219	CCCCCn1c2nccnc2c(=O)n(CCCC(=O)OCC)c1=O	InChI=1S/C17H24N4O4/c1-3-5-6-11-20-15-14(18-9-10-19-15)16(23)21(17(20)24)12-7-8-13(22)25-4-2/h9-10H,3-8,11-12H2,1-2H3	BBAGCYUWNRWIFG-UHFFFAOYSA-N	50048932	4-(2,4-Dioxo-1-pentyl-1,4-dihydro-2H-pteridin-3-yl)-butyric acid ethyl ester::CHEMBL171179	Tumor necrosis factor	Homo sapiens		 16000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048932	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048932&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10712721	103979313		CHEMBL171179					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079220	CCOC(=O)CCCn1c(=O)n(C)c2ncn(C)c2c1=O	InChI=1S/C13H18N4O4/c1-4-21-9(18)6-5-7-17-12(19)10-11(14-8-15(10)2)16(3)13(17)20/h8H,4-7H2,1-3H3	QKFRLVCLKWZGIU-UHFFFAOYSA-N	50048933	4-(3,7-Dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-purin-1-yl)-butyric acid ethyl ester::CHEMBL170479	Tumor necrosis factor	Homo sapiens		 6000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048933	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048933&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			9904193	103979314		CHEMBL170479					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079221	CCOC(=O)CCCn1c(=O)n(Cc2ccccc2)c2nccnc2c1=O	InChI=1S/C19H20N4O4/c1-2-27-15(24)9-6-12-22-18(25)16-17(21-11-10-20-16)23(19(22)26)13-14-7-4-3-5-8-14/h3-5,7-8,10-11H,2,6,9,12-13H2,1H3	YCNOKTUYVZHFCZ-UHFFFAOYSA-N	50048934	4-(1-Benzyl-2,4-dioxo-1,4-dihydro-2H-pteridin-3-yl)-butyric acid ethyl ester::CHEMBL170395	Tumor necrosis factor	Homo sapiens		 175000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048934	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048934&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10546983	103979315		CHEMBL170395					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079222	Cn1cnc2n(C)c(=O)n(CCCC(O)=O)c(=O)c12	InChI=1S/C11H14N4O4/c1-13-6-12-9-8(13)10(18)15(11(19)14(9)2)5-3-4-7(16)17/h6H,3-5H2,1-2H3,(H,16,17)	WKASGTGXOGALBG-UHFFFAOYSA-N	50048936	4-(3,7-Dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-purin-1-yl)-butyric acid::1-[4-Carboxypropyl]-3,7-Dimethylxanthine (Metabolite-V)::CHEMBL1343	Tumor necrosis factor	Homo sapiens		>200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048936	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048936&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			151419	103979317		CHEMBL1343					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079223	CCOC(=O)CCCn1c(=O)n(C)c2ccccc2c1=O	InChI=1S/C15H18N2O4/c1-3-21-13(18)9-6-10-17-14(19)11-7-4-5-8-12(11)16(2)15(17)20/h4-5,7-8H,3,6,9-10H2,1-2H3	ICYFYZKFVKFCTP-UHFFFAOYSA-N	50048939	4-(1-Methyl-2,4-dioxo-1,4-dihydro-2H-quinazolin-3-yl)-butyric acid ethyl ester::CHEMBL174253	Tumor necrosis factor	Homo sapiens		 55000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048939	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048939&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10755908	103979320		CHEMBL174253					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079224	COC(=O)c1ccc(Cn2c(=O)n(C)c3ncn(C)c3c2=O)cc1	InChI=1S/C16H16N4O4/c1-18-9-17-13-12(18)14(21)20(16(23)19(13)2)8-10-4-6-11(7-5-10)15(22)24-3/h4-7,9H,8H2,1-3H3	DWSNDHBPYVVGPX-UHFFFAOYSA-N	50048937	4-(3,7-Dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-purin-1-ylmethyl)-benzoic acid methyl ester::CHEMBL354263	Tumor necrosis factor	Homo sapiens		>200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048937	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048937&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10782487	103979318		CHEMBL354263					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079225	CC(=O)CCCCN1C(=O)c2c(ncn2C)N(C1=O)C	InChI=1S/C13H18N4O3/c1-9(18)6-4-5-7-17-12(19)10-11(14-8-15(10)2)16(3)13(17)20/h8H,4-7H2,1-3H3	BYPFEZZEUUWMEJ-UHFFFAOYSA-N	10850	1-(5-Oxohexyl)theobromine (pentoxifylline)::3,7-dimethyl-1-(5-oxohexyl)-3,7-dihydropurine-2,6-dione::CHEMBL628::3,7-dimethyl-1-(5-oxohexyl)-2,3,6,7-tetrahydro-1H-purine-2,6-dione::Pentoxil::Pentoxyphylline::Pentoxifylline	Tumor necrosis factor	Homo sapiens		 85000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=10850	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=10850&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	PNX	2A3C,3ARR,3ARU,3TVX,9E18,9E19	4740	46511426		CHEMBL628	DB00806		C07424		1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079226	CCCCCCn1c(=O)c2NC(O)Nc2n(C)c1=O	InChI=1S/C12H20N4O3/c1-3-4-5-6-7-16-10(17)8-9(14-11(18)13-8)15(2)12(16)19/h11,13-14,18H,3-7H2,1-2H3	STUDKCNIAIXYMT-UHFFFAOYSA-N	50048940	1-Hexyl-8-hydroxy-3-methyl-3,7,8,9-tetrahydro-purine-2,6-dione::CHEMBL423609	Tumor necrosis factor	Homo sapiens		 50000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048940	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048940&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			44382640	103979321		CHEMBL423609					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079227	CCCn1c2nsnc2c(=O)n(CCCC(=O)OCC)c1=O	InChI=1S/C13H18N4O4S/c1-3-7-16-11-10(14-22-15-11)12(19)17(13(16)20)8-5-6-9(18)21-4-2/h3-8H2,1-2H3	BQTWQXROTHEKOD-UHFFFAOYSA-N	50048935	4-(5,7-Dioxo-4-propyl-4,5-dihydro-7H-[1,2,5]thiadiazolo[3,4-d]pyrimidin-6-yl)-butyric acid ethyl ester::CHEMBL368458	Tumor necrosis factor	Homo sapiens		 18000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048935	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048935&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10758494	103979316		CHEMBL368458					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079228	CCOC(=O)Cn1c(=O)n(C)c2ncn(C)c2c1=O	InChI=1S/C11H14N4O4/c1-4-19-7(16)5-15-10(17)8-9(12-6-13(8)2)14(3)11(15)18/h6H,4-5H2,1-3H3	FPVZRTFTMXAZJO-UHFFFAOYSA-N	50048941	(3,7-Dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-purin-1-yl)-acetic acid ethyl ester::CHEMBL354675	Tumor necrosis factor	Homo sapiens		 200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048941	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048941&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			676987	103979322		CHEMBL354675					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079229	Cn1c2nsnc2c(=O)n(CCCC(O)=O)c1=O	InChI=1S/C9H10N4O4S/c1-12-7-6(10-18-11-7)8(16)13(9(12)17)4-2-3-5(14)15/h2-4H2,1H3,(H,14,15)	YDSYPMCBNDSKHS-UHFFFAOYSA-N	50048946	4-(4-Methyl-5,7-dioxo-4,5-dihydro-7H-[1,2,5]thiadiazolo[3,4-d]pyrimidin-6-yl)-butyric acid::CHEMBL355433	Tumor necrosis factor	Homo sapiens		>200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048946	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048946&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10539960	103979327		CHEMBL355433					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079230	CCOC(=O)CCCn1c(=O)n(C)c2nsnc2c1=O	InChI=1S/C11H14N4O4S/c1-3-19-7(16)5-4-6-15-10(17)8-9(13-20-12-8)14(2)11(15)18/h3-6H2,1-2H3	NWKIPLQXBFXVBJ-UHFFFAOYSA-N	50048942	4-(4-Methyl-5,7-dioxo-4,5-dihydro-7H-[1,2,5]thiadiazolo[3,4-d]pyrimidin-6-yl)-butyric acid ethyl ester::CHEMBL263480	Tumor necrosis factor	Homo sapiens		 25000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048942	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048942&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10590173	103979323		CHEMBL263480					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079231	CCOC(=O)CCCn1c(=O)n(C)c2[nH]c(=S)n(C)c2c1=O	InChI=1S/C13H18N4O4S/c1-4-21-8(18)6-5-7-17-11(19)9-10(16(3)13(17)20)14-12(22)15(9)2/h4-7H2,1-3H3,(H,14,22)	ALYIBTZKAIODLH-UHFFFAOYSA-N	50048945	4-(8-Mercapto-3,7-dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-purin-1-yl)-butyric acid ethyl ester::CHEMBL170855	Tumor necrosis factor	Homo sapiens		 100000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048945	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048945&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10663883	103979326		CHEMBL170855					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079232	Cn1c2nccnc2c(=O)n(CCCC(O)=O)c1=O	InChI=1S/C11H12N4O4/c1-14-9-8(12-4-5-13-9)10(18)15(11(14)19)6-2-3-7(16)17/h4-5H,2-3,6H2,1H3,(H,16,17)	FLZZBVWXXRSQPR-UHFFFAOYSA-N	50048944	4-(1-Methyl-2,4-dioxo-1,4-dihydro-2H-pteridin-3-yl)-butyric acid::CHEMBL169882	Tumor necrosis factor	Homo sapiens		>200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048944	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048944&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10515726	103979325		CHEMBL169882					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079233	CCOC(=O)CCCn1c(=O)n(C)c2nccnc2c1=O	InChI=1S/C13H16N4O4/c1-3-21-9(18)5-4-8-17-12(19)10-11(15-7-6-14-10)16(2)13(17)20/h6-7H,3-5,8H2,1-2H3	TVTAPQLHTMRRPT-UHFFFAOYSA-N	50048943	4-(1-Methyl-2,4-dioxo-1,4-dihydro-2H-pteridin-3-yl)-butyric acid ethyl ester::CHEMBL169239	Tumor necrosis factor	Homo sapiens		 12000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048943	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048943&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10779971	103979324		CHEMBL169239					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079234	CCOC(=O)CCCn1c(=O)n(CC(C)C)c2nccnc2c1=O	InChI=1S/C16H22N4O4/c1-4-24-12(21)6-5-9-19-15(22)13-14(18-8-7-17-13)20(16(19)23)10-11(2)3/h7-8,11H,4-6,9-10H2,1-3H3	ZLCAXCWFIWBCBM-UHFFFAOYSA-N	50048948	4-(1-Isobutyl-2,4-dioxo-1,4-dihydro-2H-pteridin-3-yl)-butyric acid ethyl ester::CHEMBL170920	Tumor necrosis factor	Homo sapiens		 20000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048948	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048948&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10688147	103979329		CHEMBL170920					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079235	CCOC(=O)CCCn1c(=O)n(C)c2ncc(nc2c1=O)-c1ccccc1	InChI=1S/C19H20N4O4/c1-3-27-15(24)10-7-11-23-18(25)16-17(22(2)19(23)26)20-12-14(21-16)13-8-5-4-6-9-13/h4-6,8-9,12H,3,7,10-11H2,1-2H3	CXZBCRSXQWGRFO-UHFFFAOYSA-N	50048949	4-(1-Methyl-2,4-dioxo-6-phenyl-1,4-dihydro-2H-pteridin-3-yl)-butyric acid ethyl ester::CHEMBL172619	Tumor necrosis factor	Homo sapiens		>200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048949	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048949&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10737740	103979330		CHEMBL172619					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079236	CCCn1c2nccnc2c(=O)n(CCCC(O)=O)c1=O	InChI=1S/C13H16N4O4/c1-2-7-16-11-10(14-5-6-15-11)12(20)17(13(16)21)8-3-4-9(18)19/h5-6H,2-4,7-8H2,1H3,(H,18,19)	NZBUNBBZLHKYLF-UHFFFAOYSA-N	50048947	4-(2,4-Dioxo-1-propyl-1,4-dihydro-2H-pteridin-3-yl)-butyric acid::CHEMBL172224	Tumor necrosis factor	Homo sapiens		>200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048947	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048947&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			10661296	103979328		CHEMBL172224					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50079237	CCOC(=O)c1ccc(Cn2c(=O)n(C)c3[nH]c(=S)n(C)c3c2=O)cc1	InChI=1S/C17H18N4O4S/c1-4-25-15(23)11-7-5-10(6-8-11)9-21-14(22)12-13(20(3)17(21)24)18-16(26)19(12)2/h5-8H,4,9H2,1-3H3,(H,18,26)	BZXRLKVOZUWFNH-UHFFFAOYSA-N	50048950	4-(8-Mercapto-3,7-dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-purin-1-ylmethyl)-benzoic acid ethyl ester::CHEMBL170267	Tumor necrosis factor	Homo sapiens		>200000							ChEMBL	10.1021/jm940845j	10.7270/Q29S1Q46	8568809			Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA	3/1/1996	11/10/2009	University of California	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50048950	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5625&target=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50048950&enzyme=Tumor+necrosis+factor&column=ki&startPg=0&Increment=50&submit=Search			44382442	103979331		CHEMBL170267					1	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL	5MU8,9OK6,9OJY,9OJS,9OJO,6X86,6X85,6X83,6X82,6X81,5YOY,7JRA,9BN7,8Z8M,6OOZ,6OOY,5WUX,5M2M,5M2J,5M2I,4TWT,4G3Y,9DJW,3IT8,3ALQ,3L9J,2AZ5,7ASY,7QLF	Tumor necrosis factor	TNFA_HUMAN	P01375	O43647 Q9P1Q2 Q9UIV3																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
