BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50074658 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2c(Cl)cc(Cl)c2-c2nnn[nH]2)n1 InChI=1S/C22H26Cl2N8/c1-3-5-7-19-25-20(8-6-4-2)31(28-19)14-15-9-11-16(12-10-15)32-18(24)13-17(23)21(32)22-26-29-30-27-22/h9-13H,3-8,14H2,1-2H3,(H,26,27,29,30) KFQVCVVDOXBMIY-UHFFFAOYSA-N 50046076 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL276150 Type-2 angiotensin II receptor Rattus norvegicus 810000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046076 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046076&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10050519 103976947 CHEMBL276150 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074659 CCCCc1nc(C(N)=O)c(C(N)=O)n1Cc1ccc(cc1)-n1cccc1-c1nnn[nH]1 InChI=1S/C21H23N9O2/c1-2-3-6-16-24-17(19(22)31)18(20(23)32)30(16)12-13-7-9-14(10-8-13)29-11-4-5-15(29)21-25-27-28-26-21/h4-5,7-11H,2-3,6,12H2,1H3,(H2,22,31)(H2,23,32)(H,25,26,27,28) JNTFMOXDOZPNHL-UHFFFAOYSA-N 50046077 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL276381 Type-1 angiotensin II receptor B Rattus norvegicus 290 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046077 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046077&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 9980304 103976948 CHEMBL276381 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074660 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-c2ccccc2-c2nnn[nH]2)n1 InChI=1S/C24H29N7/c1-3-5-11-22-25-23(12-6-4-2)31(28-22)17-18-13-15-19(16-14-18)20-9-7-8-10-21(20)24-26-29-30-27-24/h7-10,13-16H,3-6,11-12,17H2,1-2H3,(H,26,27,29,30) LRZYXWIVLLNUPK-UHFFFAOYSA-N 50046078 5-[4'-(3,5-Dibutyl-[1,2,4]triazol-1-ylmethyl)-biphenyl-2-yl]-1H-tetrazole::SC-50560::5-[4'-(3,5-Dibutyl-[1,2,4]triazol-1-ylmethyl)-biphenyl-2-yl]-2H-tetrazole::CHEMBL85595 Type-1 angiotensin II receptor B Rattus norvegicus 6.5 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046078 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046078&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 9931685 103976949 CHEMBL85595 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074661 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2cccc2-c2nnn[nH]2)n1 InChI=1S/C22H28N8/c1-3-5-9-20-23-21(10-6-4-2)30(26-20)16-17-11-13-18(14-12-17)29-15-7-8-19(29)22-24-27-28-25-22/h7-8,11-15H,3-6,9-10,16H2,1-2H3,(H,24,25,27,28) CJPSMBLYVBCGDL-UHFFFAOYSA-N 50046079 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12810 Type-1 angiotensin II receptor B Rattus norvegicus 33 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046079 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046079&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 10408951 103976950 CHEMBL12810 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074662 CCCCC1=NC(Cl)C(CO)N1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1 |t:4| InChI=1S/C22H25ClN6O/c1-2-3-8-20-24-21(23)19(14-30)29(20)13-15-9-11-16(12-10-15)17-6-4-5-7-18(17)22-25-27-28-26-22/h4-7,9-12,19,21,30H,2-3,8,13-14H2,1H3,(H,25,26,27,28) JGABCUJSSAEYFF-UHFFFAOYSA-N 50009714 CHEMBL191::{2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-4,5-dihydro-3H-imidazol-4-yl}-methanol(DuP 753) Type-1 angiotensin II receptor B Rattus norvegicus 36000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50009714 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50009714&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 44330456 103922696 CHEMBL191 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074663 CCCCC1=NC(Cl)C(CO)N1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1 |t:4| InChI=1S/C22H25ClN6O/c1-2-3-8-20-24-21(23)19(14-30)29(20)13-15-9-11-16(12-10-15)17-6-4-5-7-18(17)22-25-27-28-26-22/h4-7,9-12,19,21,30H,2-3,8,13-14H2,1H3,(H,25,26,27,28) JGABCUJSSAEYFF-UHFFFAOYSA-N 50009714 CHEMBL191::{2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-4,5-dihydro-3H-imidazol-4-yl}-methanol(DuP 753) Type-2 angiotensin II receptor Rattus norvegicus >10000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50009714 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50009714&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 44330456 103922696 CHEMBL191 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074664 CCCCc1nc(C(N)=O)c(C(N)=O)n1Cc1ccc(cc1)-n1cccc1-c1nnn[nH]1 InChI=1S/C21H23N9O2/c1-2-3-6-16-24-17(19(22)31)18(20(23)32)30(16)12-13-7-9-14(10-8-13)29-11-4-5-15(29)21-25-27-28-26-21/h4-5,7-11H,2-3,6,12H2,1H3,(H2,22,31)(H2,23,32)(H,25,26,27,28) JNTFMOXDOZPNHL-UHFFFAOYSA-N 50046077 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL276381 Type-2 angiotensin II receptor Rattus norvegicus 30000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046077 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046077&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9980304 103976948 CHEMBL276381 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074665 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-c2ccccc2C(O)=O)n1 InChI=1S/C24H29N3O2/c1-3-5-11-22-25-23(12-6-4-2)27(26-22)17-18-13-15-19(16-14-18)20-9-7-8-10-21(20)24(28)29/h7-10,13-16H,3-6,11-12,17H2,1-2H3,(H,28,29) OWYMRAJKPMBNEX-UHFFFAOYSA-N 50046080 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12766 Type-1 angiotensin II receptor B Rattus norvegicus 95 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046080 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046080&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 10475572 103976951 CHEMBL12766 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074666 CCCCc1nc(Cl)c(CO)n1Cc1ccc(cc1)-c1occc1C(O)=O InChI=1S/C20H21ClN2O4/c1-2-3-4-17-22-19(21)16(12-24)23(17)11-13-5-7-14(8-6-13)18-15(20(25)26)9-10-27-18/h5-10,24H,2-4,11-12H2,1H3,(H,25,26) NQOOFKORTOTUKO-UHFFFAOYSA-N 50009474 CHEMBL430279::2-[4-(2-Butyl-4-chloro-5-hydroxymethyl-imidazol-1-ylmethyl)-phenyl]-furan-3-carboxylic acid::{2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol Type-1 angiotensin II receptor B Rattus norvegicus 4200 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50009474 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50009474&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 15698116 103922486 CHEMBL430279 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074667 CCCCc1nc(Cl)c(CO)n1Cc1ccc(cc1)-n1cccc1C(O)=O InChI=1S/C20H22ClN3O3/c1-2-3-6-18-22-19(21)17(13-25)24(18)12-14-7-9-15(10-8-14)23-11-4-5-16(23)20(26)27/h4-5,7-11,25H,2-3,6,12-13H2,1H3,(H,26,27) GYAXXOQEGOXKRI-UHFFFAOYSA-N 50046081 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12190 Type-1 angiotensin II receptor B Rattus norvegicus 870000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046081 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046081&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 9908300 103976952 CHEMBL12190 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074668 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2ccc(c2)-c2nnn[nH]2)n1 InChI=1S/C22H28N8/c1-3-5-7-20-23-21(8-6-4-2)30(26-20)15-17-9-11-19(12-10-17)29-14-13-18(16-29)22-24-27-28-25-22/h9-14,16H,3-8,15H2,1-2H3,(H,24,25,27,28) VWUKLMGXDYHBSN-UHFFFAOYSA-N 50046082 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL13071 Type-1 angiotensin II receptor B Rattus norvegicus 2000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046082 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046082&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 10363869 103976953 CHEMBL13071 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074669 CCCCc1nc(CO)c(Cl)n1Cc1ccc(cc1)-n1cccc1C(O)=O InChI=1S/C20H22ClN3O3/c1-2-3-6-18-22-16(13-25)19(21)24(18)12-14-7-9-15(10-8-14)23-11-4-5-17(23)20(26)27/h4-5,7-11,25H,2-3,6,12-13H2,1H3,(H,26,27) DIJMQJXPQOJOMH-UHFFFAOYSA-N 50046083 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL267547 Type-2 angiotensin II receptor Rattus norvegicus 140000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046083 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046083&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9886554 103976954 CHEMBL267547 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074670 CCCCc1nc(Cl)c(CO)n1Cc1ccc(cc1)-c1ccccc1C(O)=O InChI=1S/C22H23ClN2O3/c1-2-3-8-20-24-21(23)19(14-26)25(20)13-15-9-11-16(12-10-15)17-6-4-5-7-18(17)22(27)28/h4-7,9-12,26H,2-3,8,13-14H2,1H3,(H,27,28) UUPNFNCKGJOLQE-UHFFFAOYSA-N 50003399 4'-(2-Butyl-4-chloro-5-hydroxymethyl-imidazol-1-ylmethyl)-biphenyl-2-carboxylic acid::i4'-(2-Butyl-4-chloro-5-hydroxymethyl-imidazol-1-ylmethyl)-biphenyl-2-carboxylic acid::4-Chloro-5-hydroxymethyl-3-imidazol-1-ylmethyl-biphenyl-2-carboxylic acid butyl ester::4'-(2-Butyl-4-chloro-5-hydroxymethyl-imidazol-1-ylmethyl)-biphenyl-2-carboxylic acid;H2O::CHEMBL274447::{2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol (EXP7711 (IMI)) Type-2 angiotensin II receptor Rattus norvegicus 3300 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50003399 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50003399&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 130762 103917372 CHEMBL274447 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074671 CCCCc1nc(Cl)c(CO)n1Cc1ccc(cc1)-n1cccc1C(O)=O InChI=1S/C20H22ClN3O3/c1-2-3-6-18-22-19(21)17(13-25)24(18)12-14-7-9-15(10-8-14)23-11-4-5-16(23)20(26)27/h4-5,7-11,25H,2-3,6,12-13H2,1H3,(H,26,27) GYAXXOQEGOXKRI-UHFFFAOYSA-N 50046081 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12190 Type-2 angiotensin II receptor Rattus norvegicus 59000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046081 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046081&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9908300 103976952 CHEMBL12190 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074672 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2c(Cl)cc(Cl)c2-c2nnn[nH]2)n1 InChI=1S/C22H26Cl2N8/c1-3-5-7-19-25-20(8-6-4-2)31(28-19)14-15-9-11-16(12-10-15)32-18(24)13-17(23)21(32)22-26-29-30-27-22/h9-13H,3-8,14H2,1-2H3,(H,26,27,29,30) KFQVCVVDOXBMIY-UHFFFAOYSA-N 50046076 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL276150 Type-1 angiotensin II receptor B Rattus norvegicus 52 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046076 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046076&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 10050519 103976947 CHEMBL276150 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074673 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2cc(cc2-c2nnn[nH]2)[N+]([O-])=O)n1 InChI=1S/C22H27N9O2/c1-3-5-7-20-23-21(8-6-4-2)30(26-20)14-16-9-11-17(12-10-16)29-15-18(31(32)33)13-19(29)22-24-27-28-25-22/h9-13,15H,3-8,14H2,1-2H3,(H,24,25,27,28) RZNUCHDVWZRVTL-UHFFFAOYSA-N 50046084 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12548 Type-2 angiotensin II receptor Rattus norvegicus 930000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046084 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046084&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10072403 103976955 CHEMBL12548 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074674 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2c(ccc2C(F)(F)F)-c2nnn[nH]2)n1 InChI=1S/C23H27F3N8/c1-3-5-7-20-27-21(8-6-4-2)33(30-20)15-16-9-11-17(12-10-16)34-18(22-28-31-32-29-22)13-14-19(34)23(24,25)26/h9-14H,3-8,15H2,1-2H3,(H,28,29,31,32) ZNQWCUATEOYCEQ-UHFFFAOYSA-N 50046085 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12451 Type-1 angiotensin II receptor B Rattus norvegicus 88 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046085&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 10457516 103976956 CHEMBL12451 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074675 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2ccc(c2)-c2nnn[nH]2)n1 InChI=1S/C22H28N8/c1-3-5-7-20-23-21(8-6-4-2)30(26-20)15-17-9-11-19(12-10-17)29-14-13-18(16-29)22-24-27-28-25-22/h9-14,16H,3-8,15H2,1-2H3,(H,24,25,27,28) VWUKLMGXDYHBSN-UHFFFAOYSA-N 50046082 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL13071 Type-2 angiotensin II receptor Rattus norvegicus 220000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046082 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046082&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10363869 103976953 CHEMBL13071 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074676 CCCCc1nc(Cl)c(CO)n1Cc1ccc(cc1)-c1ccccc1C(O)=O InChI=1S/C22H23ClN2O3/c1-2-3-8-20-24-21(23)19(14-26)25(20)13-15-9-11-16(12-10-15)17-6-4-5-7-18(17)22(27)28/h4-7,9-12,26H,2-3,8,13-14H2,1H3,(H,27,28) UUPNFNCKGJOLQE-UHFFFAOYSA-N 50003399 4'-(2-Butyl-4-chloro-5-hydroxymethyl-imidazol-1-ylmethyl)-biphenyl-2-carboxylic acid::i4'-(2-Butyl-4-chloro-5-hydroxymethyl-imidazol-1-ylmethyl)-biphenyl-2-carboxylic acid::4-Chloro-5-hydroxymethyl-3-imidazol-1-ylmethyl-biphenyl-2-carboxylic acid butyl ester::4'-(2-Butyl-4-chloro-5-hydroxymethyl-imidazol-1-ylmethyl)-biphenyl-2-carboxylic acid;H2O::CHEMBL274447::{2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol (EXP7711 (IMI)) Type-1 angiotensin II receptor B Rattus norvegicus 170000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50003399 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50003399&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 130762 103917372 CHEMBL274447 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074677 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2cccc2C(O)=O)n1 InChI=1S/C22H28N4O2/c1-3-5-9-20-23-21(10-6-4-2)26(24-20)16-17-11-13-18(14-12-17)25-15-7-8-19(25)22(27)28/h7-8,11-15H,3-6,9-10,16H2,1-2H3,(H,27,28) SBXXAKWKEXKGDW-UHFFFAOYSA-N 50046086 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12737 Type-1 angiotensin II receptor B Rattus norvegicus 270 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046086 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046086&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 9800025 103976957 CHEMBL12737 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074678 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2cccc2-c2nnn[nH]2)n1 InChI=1S/C22H28N8/c1-3-5-9-20-23-21(10-6-4-2)30(26-20)16-17-11-13-18(14-12-17)29-15-7-8-19(29)22-24-27-28-25-22/h7-8,11-15H,3-6,9-10,16H2,1-2H3,(H,24,25,27,28) CJPSMBLYVBCGDL-UHFFFAOYSA-N 50046079 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12810 Type-2 angiotensin II receptor Rattus norvegicus 260000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046079 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046079&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10408951 103976950 CHEMBL12810 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074679 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2c(ccc2C(F)(F)F)-c2nnn[nH]2)n1 InChI=1S/C23H27F3N8/c1-3-5-7-20-27-21(8-6-4-2)33(30-20)15-16-9-11-17(12-10-16)34-18(22-28-31-32-29-22)13-14-19(34)23(24,25)26/h9-14H,3-8,15H2,1-2H3,(H,28,29,31,32) ZNQWCUATEOYCEQ-UHFFFAOYSA-N 50046085 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12451 Type-2 angiotensin II receptor Rattus norvegicus 450000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046085&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10457516 103976956 CHEMBL12451 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074680 CCCCc1nc(CO)c(Cl)n1Cc1ccc(cc1)-n1cccc1C(O)=O InChI=1S/C20H22ClN3O3/c1-2-3-6-18-22-16(13-25)19(21)24(18)12-14-7-9-15(10-8-14)23-11-4-5-17(23)20(26)27/h4-5,7-11,25H,2-3,6,12-13H2,1H3,(H,26,27) DIJMQJXPQOJOMH-UHFFFAOYSA-N 50046083 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL267547 Type-1 angiotensin II receptor B Rattus norvegicus 1100 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046083 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046083&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 9886554 103976954 CHEMBL267547 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074681 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2cccc2C(O)=O)n1 InChI=1S/C22H28N4O2/c1-3-5-9-20-23-21(10-6-4-2)26(24-20)16-17-11-13-18(14-12-17)25-15-7-8-19(25)22(27)28/h7-8,11-15H,3-6,9-10,16H2,1-2H3,(H,27,28) SBXXAKWKEXKGDW-UHFFFAOYSA-N 50046086 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12737 Type-2 angiotensin II receptor Rattus norvegicus 159000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046086 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046086&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9800025 103976957 CHEMBL12737 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50074682 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2c(F)ccc2-c2nnn[nH]2)n1 InChI=1S/C22H27FN8/c1-3-5-7-20-24-21(8-6-4-2)30(27-20)15-16-9-11-17(12-10-16)31-18(13-14-19(31)23)22-25-28-29-26-22/h9-14H,3-8,15H2,1-2H3,(H,25,26,28,29) VDZZNCDKBGJLLO-UHFFFAOYSA-N 50046087 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12693 Type-1 angiotensin II receptor B Rattus norvegicus 72 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046087 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046087&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 10320063 103976958 CHEMBL12693 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074683 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2cc(cc2-c2nnn[nH]2)[N+]([O-])=O)n1 InChI=1S/C22H27N9O2/c1-3-5-7-20-23-21(8-6-4-2)30(26-20)14-16-9-11-17(12-10-16)29-15-18(31(32)33)13-19(29)22-24-27-28-25-22/h9-13,15H,3-8,14H2,1-2H3,(H,24,25,27,28) RZNUCHDVWZRVTL-UHFFFAOYSA-N 50046084 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12548 Type-1 angiotensin II receptor B Rattus norvegicus 480 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046084 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000273&target=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046084&enzyme=Type-1+angiotensin+II+receptor+B&column=ki&startPg=0&Increment=50&submit=Search 10072403 103976955 CHEMBL12548 1 MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE Type-1 angiotensin II receptor B AGTRB_RAT P29089 50074684 CCCCc1nc(CCCC)n(Cc2ccc(cc2)-n2c(F)ccc2-c2nnn[nH]2)n1 InChI=1S/C22H27FN8/c1-3-5-7-20-24-21(8-6-4-2)30(27-20)15-16-9-11-17(12-10-16)31-18(13-14-19(31)23)22-25-28-29-26-22/h9-14H,3-8,15H2,1-2H3,(H,25,26,28,29) VDZZNCDKBGJLLO-UHFFFAOYSA-N 50046087 {2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazol-4-yl}-methanol::CHEMBL12693 Type-2 angiotensin II receptor Rattus norvegicus 230000 ChEMBL 10.1021/jm00053a013 10.7270/Q2KH0MDW 8421274 Bovy, PR; Reitz, DB; Collins, JT; Chamberlain, TS; Olins, GM; Corpus, VM; McMahon, EG; Palomo, MA; Koepke, JP; Smits, GJ 2/16/1993 11/10/2009 Searle http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50046087 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50046087&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10320063 103976958 CHEMBL12693 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351