BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50038002	OC(=O)CC[C@@H](CSc1ccc(Cc2ccccc2)cc1)NC(=O)CCCCCCc1ccccc1	InChI=1S/C31H37NO3S/c33-30(16-10-2-1-5-11-25-12-6-3-7-13-25)32-28(19-22-31(34)35)24-36-29-20-17-27(18-21-29)23-26-14-8-4-9-15-26/h3-4,6-9,12-15,17-18,20-21,28H,1-2,5,10-11,16,19,22-24H2,(H,32,33)(H,34,35)	BLFSPSZATDQQMK-UHFFFAOYSA-N	50040461	(S)-5-(4-Benzyl-phenylsulfanyl)-4-(7-phenyl-heptanoylamino)-pentanoic acid::(S)-5-(4-Benzyl-phenylsulfanyl)-4-((S)-7-phenyl-heptanoylamino)-pentanoic acid::CHEMBL434630	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 30							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040461	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040461&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			127885	103972505		CHEMBL434630					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50038003	OC(=O)CC[C@@H](CSc1ccc(Cc2ccccc2)cc1)NC(=O)CCCCCCc1ccccc1	InChI=1S/C31H37NO3S/c33-30(16-10-2-1-5-11-25-12-6-3-7-13-25)32-28(19-22-31(34)35)24-36-29-20-17-27(18-21-29)23-26-14-8-4-9-15-26/h3-4,6-9,12-15,17-18,20-21,28H,1-2,5,10-11,16,19,22-24H2,(H,32,33)(H,34,35)	BLFSPSZATDQQMK-UHFFFAOYSA-N	50040461	(S)-5-(4-Benzyl-phenylsulfanyl)-4-(7-phenyl-heptanoylamino)-pentanoic acid::(S)-5-(4-Benzyl-phenylsulfanyl)-4-((S)-7-phenyl-heptanoylamino)-pentanoic acid::CHEMBL434630	Phospholipase A2, membrane associated	Homo sapiens		 21							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040461	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2429&target=Phospholipase+A2%2C+membrane+associated&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040461&enzyme=Phospholipase+A2%2C+membrane+associated&column=ki&startPg=0&Increment=50&submit=Search			127885	103972505		CHEMBL434630					1	MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC	3U8H,3U8D,3U8B,1POE,1POD,1KVO,1KQU,1J1A,1DCY,1DB5,1DB4,1BBC,1AYP,1N29	Phospholipase A2, membrane associated	PA2GA_HUMAN	P14555	A8K5I7 Q6DN24 Q6IBD9 Q9UCD2			N/A	A0A024RA96																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																														
50064464	CCCCCCCCCCCCCCCC(=O)N[C@H](CC(C)C)C(O)=O	InChI=1S/C22H43NO3/c1-4-5-6-7-8-9-10-11-12-13-14-15-16-17-21(24)23-20(22(25)26)18-19(2)3/h19-20H,4-18H2,1-3H3,(H,23,24)(H,25,26)	UEWVQOCQZFYTBW-UHFFFAOYSA-N	50040457	(R)-2-((S)-Hexadecanoylamino)-4-methyl-pentanoic acid::CHEMBL149343	Group 10 secretory phospholipase A2	Homo sapiens		>30000							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040457	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040457&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			10067704	103972501		CHEMBL149343					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064465	CCCCCC\C=C\CC(=O)N[C@H](CSc1ccc(Cc2ccccc2)cc1)CC(O)=O	InChI=1S/C27H35NO3S/c1-2-3-4-5-6-7-11-14-26(29)28-24(20-27(30)31)21-32-25-17-15-23(16-18-25)19-22-12-9-8-10-13-22/h7-13,15-18,24H,2-6,14,19-21H2,1H3,(H,28,29)(H,30,31)	GNHFIABSJRZERZ-UHFFFAOYSA-N	50040455	(S)-4-(4-Benzyl-phenylsulfanyl)-3-((S)-(E)-dec-3-enoylamino)-butyric acid::CHEMBL152921	Group 10 secretory phospholipase A2	Homo sapiens		 120							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040455	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040455&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			10095448	103972499		CHEMBL152921					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064466	CCCCCCCCCCCCCCCC(=O)N[C@@H](COP([O-])(=O)OCC[N+](C)(C)C)CC(C)C	InChI=1S/C27H57N2O5P/c1-7-8-9-10-11-12-13-14-15-16-17-18-19-20-27(30)28-26(23-25(2)3)24-34-35(31,32)33-22-21-29(4,5)6/h25-26H,7-24H2,1-6H3,(H-,28,30,31,32)	VRBRGHOCXOVDKR-UHFFFAOYSA-N	50004499	(R)-O-(2-Hexadecanamidoisohexyl) phosphocholine::CHEMBL322409::{2-[(2-Hexadecanoyl amino-4-methyl-p entyloxy)-hydroxy-phoryloxy]-ethyl}-trimethyl-ammonium	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 300							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50004499	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50004499&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			15667276	103918130		CHEMBL322409					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064467	CCCCCCCCCCCCCCCC(=O)N[C@H](CC(C)C)CC(O)=O	InChI=1S/C23H45NO3/c1-4-5-6-7-8-9-10-11-12-13-14-15-16-17-22(25)24-21(18-20(2)3)19-23(26)27/h20-21H,4-19H2,1-3H3,(H,24,25)(H,26,27)	KRXHUKOIHOKPGS-UHFFFAOYSA-N	50040456	(R)-3-((S)-Hexadecanoylamino)-5-methyl-hexanoic acid::CHEMBL347055	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 190							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040456	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040456&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			10385302	103972500		CHEMBL347055					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064468	CCCCCCCCCCCCCCCC(=O)N[C@H](CC(C)C)CC(O)=O	InChI=1S/C23H45NO3/c1-4-5-6-7-8-9-10-11-12-13-14-15-16-17-22(25)24-21(18-20(2)3)19-23(26)27/h20-21H,4-19H2,1-3H3,(H,24,25)(H,26,27)	KRXHUKOIHOKPGS-UHFFFAOYSA-N	50040456	(R)-3-((S)-Hexadecanoylamino)-5-methyl-hexanoic acid::CHEMBL347055	Group 10 secretory phospholipase A2	Homo sapiens		 7300							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040456	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040456&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			10385302	103972500		CHEMBL347055					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064469	CCCCCC\C=C\CC(=O)N[C@@H](CCC(O)=O)CSc1ccc2ccccc2c1	InChI=1S/C25H33NO3S/c1-2-3-4-5-6-7-8-13-24(27)26-22(15-17-25(28)29)19-30-23-16-14-20-11-9-10-12-21(20)18-23/h7-12,14,16,18,22H,2-6,13,15,17,19H2,1H3,(H,26,27)(H,28,29)	PLKZQOUEMBHADV-UHFFFAOYSA-N	50040458	(S)-4-((S)-(E)-Dec-3-enoylamino)-5-(naphthalen-2-ylsulfanyl)-pentanoic acid::CHEMBL152402	Group 10 secretory phospholipase A2	Homo sapiens		 380							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040458	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040458&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			10048183	103972502		CHEMBL152402					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064470	CCCCCC\C=C\CC(=O)N[C@@H](CCC(O)=O)CSc1ccc2ccccc2c1	InChI=1S/C25H33NO3S/c1-2-3-4-5-6-7-8-13-24(27)26-22(15-17-25(28)29)19-30-23-16-14-20-11-9-10-12-21(20)18-23/h7-12,14,16,18,22H,2-6,13,15,17,19H2,1H3,(H,26,27)(H,28,29)	PLKZQOUEMBHADV-UHFFFAOYSA-N	50040458	(S)-4-((S)-(E)-Dec-3-enoylamino)-5-(naphthalen-2-ylsulfanyl)-pentanoic acid::CHEMBL152402	Phospholipase A2, membrane associated	Homo sapiens		 1850							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040458	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2429&target=Phospholipase+A2%2C+membrane+associated&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040458&enzyme=Phospholipase+A2%2C+membrane+associated&column=ki&startPg=0&Increment=50&submit=Search			10048183	103972502		CHEMBL152402					1	MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC	3U8H,3U8D,3U8B,1POE,1POD,1KVO,1KQU,1J1A,1DCY,1DB5,1DB4,1BBC,1AYP,1N29	Phospholipase A2, membrane associated	PA2GA_HUMAN	P14555	A8K5I7 Q6DN24 Q6IBD9 Q9UCD2			N/A	A0A024RA96																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																														
50064471	CCCCCCCCCC(=O)N[C@H](CC(C)C)CC(O)=O	InChI=1S/C17H33NO3/c1-4-5-6-7-8-9-10-11-16(19)18-15(12-14(2)3)13-17(20)21/h14-15H,4-13H2,1-3H3,(H,18,19)(H,20,21)	NGAJSICLJNHIMO-UHFFFAOYSA-N	50040459	(R)-3-((S)-Decanoylamino)-5-methyl-hexanoic acid::CHEMBL152773	Group 10 secretory phospholipase A2	Homo sapiens		 15000							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040459	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040459&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			10380017	103972503		CHEMBL152773					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064472	CCCCCCCCCCCCCCCC(=O)N[C@@H](COP([O-])(=O)OCC[N+](C)(C)C)CC(C)C	InChI=1S/C27H57N2O5P/c1-7-8-9-10-11-12-13-14-15-16-17-18-19-20-27(30)28-26(23-25(2)3)24-34-35(31,32)33-22-21-29(4,5)6/h25-26H,7-24H2,1-6H3,(H-,28,30,31,32)	VRBRGHOCXOVDKR-UHFFFAOYSA-N	50004499	(R)-O-(2-Hexadecanamidoisohexyl) phosphocholine::CHEMBL322409::{2-[(2-Hexadecanoyl amino-4-methyl-p entyloxy)-hydroxy-phoryloxy]-ethyl}-trimethyl-ammonium	Group 10 secretory phospholipase A2	Homo sapiens		 30000							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50004499	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50004499&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			15667276	103918130		CHEMBL322409					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064473	CCCCCC\C=C\CC(=O)N[C@H](CCC(O)=O)CSc1ccc2ccccc2c1	InChI=1S/C25H33NO3S/c1-2-3-4-5-6-7-8-13-24(27)26-22(15-17-25(28)29)19-30-23-16-14-20-11-9-10-12-21(20)18-23/h7-12,14,16,18,22H,2-6,13,15,17,19H2,1H3,(H,26,27)(H,28,29)	PLKZQOUEMBHADV-UHFFFAOYSA-N	50040460	(R)-4-((R)-(E)-Dec-3-enoylamino)-5-(naphthalen-2-ylsulfanyl)-pentanoic acid::CHEMBL152562	Group 10 secretory phospholipase A2	Homo sapiens		>100000							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040460	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040460&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			10432691	103972504		CHEMBL152562					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064475	CCCCCC\C=C\CC(=O)N[C@H](CCC(O)=O)CSc1ccc2ccccc2c1	InChI=1S/C25H33NO3S/c1-2-3-4-5-6-7-8-13-24(27)26-22(15-17-25(28)29)19-30-23-16-14-20-11-9-10-12-21(20)18-23/h7-12,14,16,18,22H,2-6,13,15,17,19H2,1H3,(H,26,27)(H,28,29)	PLKZQOUEMBHADV-UHFFFAOYSA-N	50040460	(R)-4-((R)-(E)-Dec-3-enoylamino)-5-(naphthalen-2-ylsulfanyl)-pentanoic acid::CHEMBL152562	Phospholipase A2, membrane associated	Homo sapiens		 12000							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040460	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2429&target=Phospholipase+A2%2C+membrane+associated&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040460&enzyme=Phospholipase+A2%2C+membrane+associated&column=ki&startPg=0&Increment=50&submit=Search			10432691	103972504		CHEMBL152562					1	MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC	3U8H,3U8D,3U8B,1POE,1POD,1KVO,1KQU,1J1A,1DCY,1DB5,1DB4,1BBC,1AYP,1N29	Phospholipase A2, membrane associated	PA2GA_HUMAN	P14555	A8K5I7 Q6DN24 Q6IBD9 Q9UCD2			N/A	A0A024RA96																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																														
50064476	CCCCCC\C=C\CC(=O)N[C@H](CC(C)C)CC(O)=O	InChI=1S/C17H31NO3/c1-4-5-6-7-8-9-10-11-16(19)18-15(12-14(2)3)13-17(20)21/h9-10,14-15H,4-8,11-13H2,1-3H3,(H,18,19)(H,20,21)	HDVXAQLYEYFXSJ-UHFFFAOYSA-N	50040462	(R)-3-((S)-(E)-Dec-3-enoylamino)-5-methyl-hexanoic acid::CHEMBL150732	Group 10 secretory phospholipase A2	Homo sapiens		 8500							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040462	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040462&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			9971867	103972506		CHEMBL150732					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064477	CCCCCCCCCCCCCCCC(=O)N[C@@H](CCC(O)=O)CC(C)C	InChI=1S/C24H47NO3/c1-4-5-6-7-8-9-10-11-12-13-14-15-16-17-23(26)25-22(20-21(2)3)18-19-24(27)28/h21-22H,4-20H2,1-3H3,(H,25,26)(H,27,28)	RMPBHUCYVVCRTM-UHFFFAOYSA-N	50040463	(S)-4-((S)-Hexadecanoylamino)-6-methyl-heptanoic acid::CHEMBL347066	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 200							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040463	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040463&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			10318655	103972507		CHEMBL347066					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064478	CCCCCC\C=C\CC(=O)N[C@H](CSc1ccc2ccccc2c1)CC(O)=O	InChI=1S/C24H31NO3S/c1-2-3-4-5-6-7-8-13-23(26)25-21(17-24(27)28)18-29-22-15-14-19-11-9-10-12-20(19)16-22/h7-12,14-16,21H,2-6,13,17-18H2,1H3,(H,25,26)(H,27,28)	UCVBUYTVQOAQJO-UHFFFAOYSA-N	50040464	(S)-3-((S)-(E)-Dec-3-enoylamino)-4-(naphthalen-2-ylsulfanyl)-butyric acid::CHEMBL152031	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 23							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040464	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040464&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			10341681	103972508		CHEMBL152031					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064479	CCCCCCCCCCCCCCCC(=O)N[C@@H](CCC(O)=O)CC(C)C	InChI=1S/C24H47NO3/c1-4-5-6-7-8-9-10-11-12-13-14-15-16-17-23(26)25-22(20-21(2)3)18-19-24(27)28/h21-22H,4-20H2,1-3H3,(H,25,26)(H,27,28)	RMPBHUCYVVCRTM-UHFFFAOYSA-N	50040463	(S)-4-((S)-Hexadecanoylamino)-6-methyl-heptanoic acid::CHEMBL347066	Group 10 secretory phospholipase A2	Homo sapiens		 4500							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040463	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040463&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			10318655	103972507		CHEMBL347066					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064480	CCCCCC\C=C\CC(=O)N[C@H](CSc1ccccc1)CC(O)=O	InChI=1S/C20H29NO3S/c1-2-3-4-5-6-7-11-14-19(22)21-17(15-20(23)24)16-25-18-12-9-8-10-13-18/h7-13,17H,2-6,14-16H2,1H3,(H,21,22)(H,23,24)	CBZCAUILHUNILM-UHFFFAOYSA-N	50040465	(S)-3-((S)-(E)-Dec-3-enoylamino)-4-phenylsulfanyl-butyric acid::CHEMBL357750	Group 10 secretory phospholipase A2	Homo sapiens		 2200							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040465	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040465&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			10361372	103972509		CHEMBL357750					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064481	CCCCCC\C=C\CC(=O)N[C@H](CSc1ccccc1)CC(O)=O	InChI=1S/C20H29NO3S/c1-2-3-4-5-6-7-11-14-19(22)21-17(15-20(23)24)16-25-18-12-9-8-10-13-18/h7-13,17H,2-6,14-16H2,1H3,(H,21,22)(H,23,24)	CBZCAUILHUNILM-UHFFFAOYSA-N	50040465	(S)-3-((S)-(E)-Dec-3-enoylamino)-4-phenylsulfanyl-butyric acid::CHEMBL357750	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 95							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040465	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040465&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			10361372	103972509		CHEMBL357750					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064482	CCCCCC\C=C\CC(=O)N[C@H](CSc1ccc(Cc2ccccc2)cc1)CC(O)=O	InChI=1S/C27H35NO3S/c1-2-3-4-5-6-7-11-14-26(29)28-24(20-27(30)31)21-32-25-17-15-23(16-18-25)19-22-12-9-8-10-13-22/h7-13,15-18,24H,2-6,14,19-21H2,1H3,(H,28,29)(H,30,31)	GNHFIABSJRZERZ-UHFFFAOYSA-N	50040455	(S)-4-(4-Benzyl-phenylsulfanyl)-3-((S)-(E)-dec-3-enoylamino)-butyric acid::CHEMBL152921	Phospholipase A2, membrane associated	Homo sapiens		 3800							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040455	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2429&target=Phospholipase+A2%2C+membrane+associated&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040455&enzyme=Phospholipase+A2%2C+membrane+associated&column=ki&startPg=0&Increment=50&submit=Search			10095448	103972499		CHEMBL152921					1	MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC	3U8H,3U8D,3U8B,1POE,1POD,1KVO,1KQU,1J1A,1DCY,1DB5,1DB4,1BBC,1AYP,1N29	Phospholipase A2, membrane associated	PA2GA_HUMAN	P14555	A8K5I7 Q6DN24 Q6IBD9 Q9UCD2			N/A	A0A024RA96																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																														
50064483	CCCCCC\C=C\CC(=O)N[C@H](CSc1ccc(Cc2ccccc2)cc1)CC(O)=O	InChI=1S/C27H35NO3S/c1-2-3-4-5-6-7-11-14-26(29)28-24(20-27(30)31)21-32-25-17-15-23(16-18-25)19-22-12-9-8-10-13-22/h7-13,15-18,24H,2-6,14,19-21H2,1H3,(H,28,29)(H,30,31)	GNHFIABSJRZERZ-UHFFFAOYSA-N	50040455	(S)-4-(4-Benzyl-phenylsulfanyl)-3-((S)-(E)-dec-3-enoylamino)-butyric acid::CHEMBL152921	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 30							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040455	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040455&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			10095448	103972499		CHEMBL152921					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064484	CCCCCC\C=C\CC(=O)N[C@H](CCC(O)=O)CSc1ccc2ccccc2c1	InChI=1S/C25H33NO3S/c1-2-3-4-5-6-7-8-13-24(27)26-22(15-17-25(28)29)19-30-23-16-14-20-11-9-10-12-21(20)18-23/h7-12,14,16,18,22H,2-6,13,15,17,19H2,1H3,(H,26,27)(H,28,29)	PLKZQOUEMBHADV-UHFFFAOYSA-N	50040460	(R)-4-((R)-(E)-Dec-3-enoylamino)-5-(naphthalen-2-ylsulfanyl)-pentanoic acid::CHEMBL152562	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		>250000							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040460	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040460&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			10432691	103972504		CHEMBL152562					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064485	CCCCCC\C=C\CC(=O)N[C@H](CSc1ccc2ccccc2c1)CC(O)=O	InChI=1S/C24H31NO3S/c1-2-3-4-5-6-7-8-13-23(26)25-21(17-24(27)28)18-29-22-15-14-19-11-9-10-12-20(19)16-22/h7-12,14-16,21H,2-6,13,17-18H2,1H3,(H,25,26)(H,27,28)	UCVBUYTVQOAQJO-UHFFFAOYSA-N	50040464	(S)-3-((S)-(E)-Dec-3-enoylamino)-4-(naphthalen-2-ylsulfanyl)-butyric acid::CHEMBL152031	Group 10 secretory phospholipase A2	Homo sapiens		 790.0							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040464	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040464&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			10341681	103972508		CHEMBL152031					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064486	OC(=O)C[C@@H](CSc1ccc(Cc2ccccc2)cc1)NC(=O)CCCCCCc1ccccc1	InChI=1S/C30H35NO3S/c32-29(16-10-2-1-5-11-24-12-6-3-7-13-24)31-27(22-30(33)34)23-35-28-19-17-26(18-20-28)21-25-14-8-4-9-15-25/h3-4,6-9,12-15,17-20,27H,1-2,5,10-11,16,21-23H2,(H,31,32)(H,33,34)	XWLCMGGWXNTFCV-UHFFFAOYSA-N	50040466	(S)-4-(4-Benzyl-phenylsulfanyl)-3-((S)-7-phenyl-heptanoylamino)-butyric acid::CHEMBL151141	Phospholipase A2, membrane associated	Homo sapiens		 65							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040466	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2429&target=Phospholipase+A2%2C+membrane+associated&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040466&enzyme=Phospholipase+A2%2C+membrane+associated&column=ki&startPg=0&Increment=50&submit=Search			10254980	103972510		CHEMBL151141					1	MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC	3U8H,3U8D,3U8B,1POE,1POD,1KVO,1KQU,1J1A,1DCY,1DB5,1DB4,1BBC,1AYP,1N29	Phospholipase A2, membrane associated	PA2GA_HUMAN	P14555	A8K5I7 Q6DN24 Q6IBD9 Q9UCD2			N/A	A0A024RA96																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																														
50064487	CCCCCCCCCCCCCCCC(=O)N[C@@H](CCCC(O)=O)CC(C)C	InChI=1S/C25H49NO3/c1-4-5-6-7-8-9-10-11-12-13-14-15-16-19-24(27)26-23(21-22(2)3)18-17-20-25(28)29/h22-23H,4-21H2,1-3H3,(H,26,27)(H,28,29)	AUGDTKJBFCDZHS-UHFFFAOYSA-N	50040467	(S)-5-((S)-Hexadecanoylamino)-7-methyl-octanoic acid::CHEMBL152115	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 1300							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040467	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040467&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			9979014	103972511		CHEMBL152115					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064488	CCCCCC\C=C\CC(=O)N[C@H](CC(C)C)CC(O)=O	InChI=1S/C17H31NO3/c1-4-5-6-7-8-9-10-11-16(19)18-15(12-14(2)3)13-17(20)21/h9-10,14-15H,4-8,11-13H2,1-3H3,(H,18,19)(H,20,21)	HDVXAQLYEYFXSJ-UHFFFAOYSA-N	50040462	(R)-3-((S)-(E)-Dec-3-enoylamino)-5-methyl-hexanoic acid::CHEMBL150732	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 300							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040462	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040462&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			9971867	103972506		CHEMBL150732					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064489	CCCCCCCCCCCCCCCC(=O)N[C@@H](CCCC(O)=O)CC(C)C	InChI=1S/C25H49NO3/c1-4-5-6-7-8-9-10-11-12-13-14-15-16-19-24(27)26-23(21-22(2)3)18-17-20-25(28)29/h22-23H,4-21H2,1-3H3,(H,26,27)(H,28,29)	AUGDTKJBFCDZHS-UHFFFAOYSA-N	50040467	(S)-5-((S)-Hexadecanoylamino)-7-methyl-octanoic acid::CHEMBL152115	Group 10 secretory phospholipase A2	Homo sapiens		 19000							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040467	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001527&target=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040467&enzyme=Group+10+secretory+phospholipase+A2&column=ki&startPg=0&Increment=50&submit=Search			9979014	103972511		CHEMBL152115					1	MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD	6G5J,4UY1,5OW8,5G3M,1LE7,1LE6,5OWC	Group 10 secretory phospholipase A2	PA2GX_HUMAN	O15496	Q14DU3 Q6NT23																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50064490	CCCCCCCCCCCCCCCC(=O)N[C@H](CC(C)C)C(O)=O	InChI=1S/C22H43NO3/c1-4-5-6-7-8-9-10-11-12-13-14-15-16-17-21(24)23-20(22(25)26)18-19(2)3/h19-20H,4-18H2,1-3H3,(H,23,24)(H,25,26)	UEWVQOCQZFYTBW-UHFFFAOYSA-N	50040457	(R)-2-((S)-Hexadecanoylamino)-4-methyl-pentanoic acid::CHEMBL149343	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 15000							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040457	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040457&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			10067704	103972501		CHEMBL149343					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064492	CCCCCCCCCC(=O)N[C@H](CC(C)C)CC(O)=O	InChI=1S/C17H33NO3/c1-4-5-6-7-8-9-10-11-16(19)18-15(12-14(2)3)13-17(20)21/h14-15H,4-13H2,1-3H3,(H,18,19)(H,20,21)	NGAJSICLJNHIMO-UHFFFAOYSA-N	50040459	(R)-3-((S)-Decanoylamino)-5-methyl-hexanoic acid::CHEMBL152773	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 1400							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040459	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040459&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			10380017	103972503		CHEMBL152773					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50064494	CCCCCC\C=C\CC(=O)N[C@@H](CCC(O)=O)CSc1ccc2ccccc2c1	InChI=1S/C25H33NO3S/c1-2-3-4-5-6-7-8-13-24(27)26-22(15-17-25(28)29)19-30-23-16-14-20-11-9-10-12-21(20)18-23/h7-12,14,16,18,22H,2-6,13,15,17,19H2,1H3,(H,26,27)(H,28,29)	PLKZQOUEMBHADV-UHFFFAOYSA-N	50040458	(S)-4-((S)-(E)-Dec-3-enoylamino)-5-(naphthalen-2-ylsulfanyl)-pentanoic acid::CHEMBL152402	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 16							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040458	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040458&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			10048183	103972502		CHEMBL152402					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50992768	OC(=O)CC[C@@H](CSc1ccc(Cc2ccccc2)cc1)NC(=O)CCCCCCc1ccccc1	InChI=1S/C31H37NO3S/c33-30(16-10-2-1-5-11-25-12-6-3-7-13-25)32-28(19-22-31(34)35)24-36-29-20-17-27(18-21-29)23-26-14-8-4-9-15-26/h3-4,6-9,12-15,17-18,20-21,28H,1-2,5,10-11,16,19,22-24H2,(H,32,33)(H,34,35)	BLFSPSZATDQQMK-UHFFFAOYSA-N	50040461	(S)-5-(4-Benzyl-phenylsulfanyl)-4-(7-phenyl-heptanoylamino)-pentanoic acid::(S)-5-(4-Benzyl-phenylsulfanyl)-4-((S)-7-phenyl-heptanoylamino)-pentanoic acid::CHEMBL434630	Platelet-activating factor acetylhydrolase [136-227]	Sus scrofa		 15							ChEMBL	10.1021/jm00031a001	10.7270/Q28W3CB7	8126692			Beaton, HG; Bennion, C; Connolly, S; Cook, AR; Gensmantel, NP; Hallam, C; Hardy, K; Hitchin, B; Jackson, CG; Robinson, DH	4/12/1994	11/10/2009	Fisons	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50040461	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002703&target=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50040461&enzyme=Platelet-activating+factor+acetylhydrolase+%5B136-227%5D&column=ki&startPg=0&Increment=50&submit=Search			127885	103972505		CHEMBL434630					1	SPLRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATYFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA		Platelet-activating factor acetylhydrolase	A0A5G2RFL7_PIG	A0A5G2RFL7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
