BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50037593 O[C@@H]1CC[C@@]2(O)[C@H]3Cc4ccc(O)c5O[C@@H]1[C@]2(CCN3CC1CC1)c45 |r| InChI=1S/C20H25NO4/c22-13-4-3-12-9-15-20(24)6-5-14(23)18-19(20,16(12)17(13)25-18)7-8-21(15)10-11-1-2-11/h3-4,11,14-15,18,22-24H,1-2,5-10H2 JLVNEHKORQFVQJ-UHFFFAOYSA-N 50001709 CHEMBL558140::CHEMBL140278::4-cyclopropylmethyl-(13R)-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7,9,11(18)-triene-10,14,17-triol::Naltrexone-6-beta-ol Kappa-type opioid receptor Cavia porcellus 1.8 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001709 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001709&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5486554 103916124 CHEMBL140278CHEMBL558140 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037594 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1c2ccccc2cc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:8:7:22:18.4.5,17:18:22:7.13.12,21:22:18.4.5:7.13.12| 50453490 CHEMBL2112736 Delta-type opioid receptor Homo sapiens 48 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453490 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453490&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71452702 225145960 CHEMBL2112736 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037595 Oc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)C(=O)CC[C@@]35O InChI=1S/C20H23NO4/c22-13-4-3-12-9-15-20(24)6-5-14(23)18-19(20,16(12)17(13)25-18)7-8-21(15)10-11-1-2-11/h3-4,11,15,18,22,24H,1-2,5-10H2 DQCKKXVULJGBQN-UHFFFAOYSA-N 60212 SMR000058767::NALTREXONE HYDROCHLORIDE::MLS000069607::cid_5485201::(4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,9-bis(oxidanyl)-2,4,5,6,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-one;hydrochloride::(4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,9-dihydroxy-2,4,5,6,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-one;hydrochloride::US9107954, naltrexone::US10988481, Compound NTX::US20240208984, Compound Naltrexone Kappa-type opioid receptor Cavia porcellus 0.530000 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=60212 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=60212&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5360515 252639834 DB00704 C07253 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037596 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1cccc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453483 CHEMBL2111912 Mu-type opioid receptor Cavia porcellus 1 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453483 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453483&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456180 225145953 CHEMBL2111912 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037597 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1ccc(cc1)-c1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453489 CHEMBL2112730 Delta-type opioid receptor Homo sapiens 11 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453489 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453489&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71454481 225145959 CHEMBL2112730 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037598 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1ccc2ccccc2c1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453481 CHEMBL2111911 Mu-type opioid receptor Cavia porcellus 1.2 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453481&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71454425 225145951 CHEMBL2111911 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037599 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1ccc2ccccc2c1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453482 CHEMBL2112729 Delta-type opioid receptor Homo sapiens 25 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453482 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453482&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456225 225145952 CHEMBL2112729 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037600 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453488 CHEMBL2112732 Delta-type opioid receptor Homo sapiens 2.9 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453488 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453488&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456227 225145958 CHEMBL2112732 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037601 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)C(CCC35O)OCC(=O)C1[C@H]2C[C@@H]3C[C@@H](C[C@H]1C3)C2 |wU:33.44,31.36,35.40,wD:29.45,TLB:26:28:34:31.36.32,23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,30:29:34:31.36.32,30:31:29.28.37:34,21:22:18.4.5:7.13.12,8:7:22:18.4.5,(4.96,-10.23,;3.61,-9.46,;2.28,-10.23,;.94,-9.46,;.94,-7.89,;-.38,-7.15,;-.38,-5.61,;-1.73,-5.25,;-3.04,-4.5,;-3.06,-2.96,;-2.3,-1.62,;-3.85,-1.62,;-.63,-6.35,;.72,-5.61,;2.26,-5.61,;3.71,-5.15,;4.61,-6.37,;3.61,-7.89,;2.28,-7.14,;5.32,-4.45,;3.81,-4.06,;2.49,-4.84,;.94,-4.86,;.53,-3.36,;6.64,-3.68,;7.98,-4.42,;9.5,-3.9,;10.14,-5.19,;10.58,-2.78,;12.04,-2.28,;13.49,-2.78,;14.44,-1.45,;14.38,.1,;12.94,.6,;11.62,.05,;11.71,-1.43,;13.06,-1.87,;11.96,-.69,)| 50038293 17-(cyclopropylmethyl)-4,5alpha-epoxy-3,14-dihydroxy-6beta-morphinanyl 2-adamantyl-2-oxoethylether::CHEMBL423341 Mu-type opioid receptor Cavia porcellus 6.6 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50038293 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50038293&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44356181 103945730 CHEMBL423341 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037602 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1ccc2ccccc2c1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453482 CHEMBL2112729 Kappa-type opioid receptor Cavia porcellus 1.5 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453482 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453482&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456225 225145952 CHEMBL2112729 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037603 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1ccc(cc1)-c1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453489 CHEMBL2112730 Kappa-type opioid receptor Cavia porcellus 1.5 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453489 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453489&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71454481 225145959 CHEMBL2112730 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037604 CC1(C)SSC(C)(C)[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(=O)NCC(=O)N[C@H](Cc2ccccc2)C(=O)N[C@H]1C(O)=O InChI=1S/C30H39N5O7S2/c1-29(2)23(34-25(38)20(31)14-18-10-12-19(36)13-11-18)27(40)32-16-22(37)33-21(15-17-8-6-5-7-9-17)26(39)35-24(28(41)42)30(3,4)44-43-29/h5-13,20-21,23-24,36H,14-16,31H2,1-4H3,(H,32,40)(H,33,37)(H,34,38)(H,35,39)(H,41,42) MCMMCRYPQBNCPH-UHFFFAOYSA-N 50001683 CHEMBL294616::13-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-7-benzyl-3,3,14,14-tetramethyl-6,9,12-trioxo-1,2-dithia-5,8,11-triaza-cyclotetradecane-4-carboxylic acid::DPDPE::7-Benzyl-10-{[3-(4-hydroxy-phenyl)-pyrrolidine-2-carbonyl]-amino}-3,3-dimethyl-6,9-dioxo-1,2-dithia-5,8-diaza-cycloundecane-4-carboxylic acid Mu-type opioid receptor Cavia porcellus 1760 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001683 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001683&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44299404 103916113 CHEMBL294616 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037605 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)C(CCC35O)OCC(=O)C1[C@H]2C[C@@H]3C[C@@H](C[C@H]1C3)C2 |wU:33.44,31.36,35.40,wD:29.45,TLB:26:28:34:31.36.32,23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,30:29:34:31.36.32,30:31:29.28.37:34,21:22:18.4.5:7.13.12,8:7:22:18.4.5,(4.96,-10.23,;3.61,-9.46,;2.28,-10.23,;.94,-9.46,;.94,-7.89,;-.38,-7.15,;-.38,-5.61,;-1.73,-5.25,;-3.04,-4.5,;-3.06,-2.96,;-2.3,-1.62,;-3.85,-1.62,;-.63,-6.35,;.72,-5.61,;2.26,-5.61,;3.71,-5.15,;4.61,-6.37,;3.61,-7.89,;2.28,-7.14,;5.32,-4.45,;3.81,-4.06,;2.49,-4.84,;.94,-4.86,;.53,-3.36,;6.64,-3.68,;7.98,-4.42,;9.5,-3.9,;10.14,-5.19,;10.58,-2.78,;12.04,-2.28,;13.49,-2.78,;14.44,-1.45,;14.38,.1,;12.94,.6,;11.62,.05,;11.71,-1.43,;13.06,-1.87,;11.96,-.69,)| 50038293 17-(cyclopropylmethyl)-4,5alpha-epoxy-3,14-dihydroxy-6beta-morphinanyl 2-adamantyl-2-oxoethylether::CHEMBL423341 Kappa-type opioid receptor Cavia porcellus 3.3 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50038293 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50038293&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44356181 103945730 CHEMBL423341 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037606 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453488 CHEMBL2112732 Kappa-type opioid receptor Cavia porcellus 2 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453488 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453488&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456227 225145958 CHEMBL2112732 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037607 CC1(C)SSC(C)(C)[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(=O)NCC(=O)N[C@H](Cc2ccccc2)C(=O)N[C@H]1C(O)=O InChI=1S/C30H39N5O7S2/c1-29(2)23(34-25(38)20(31)14-18-10-12-19(36)13-11-18)27(40)32-16-22(37)33-21(15-17-8-6-5-7-9-17)26(39)35-24(28(41)42)30(3,4)44-43-29/h5-13,20-21,23-24,36H,14-16,31H2,1-4H3,(H,32,40)(H,33,37)(H,34,38)(H,35,39)(H,41,42) MCMMCRYPQBNCPH-UHFFFAOYSA-N 50001683 CHEMBL294616::13-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-7-benzyl-3,3,14,14-tetramethyl-6,9,12-trioxo-1,2-dithia-5,8,11-triaza-cyclotetradecane-4-carboxylic acid::DPDPE::7-Benzyl-10-{[3-(4-hydroxy-phenyl)-pyrrolidine-2-carbonyl]-amino}-3,3-dimethyl-6,9-dioxo-1,2-dithia-5,8-diaza-cycloundecane-4-carboxylic acid Delta-type opioid receptor Homo sapiens 5000 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001683 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001683&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44299404 103916113 CHEMBL294616 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037608 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1c2ccccc2cc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:8:7:22:18.4.5,17:18:22:7.13.12,21:22:18.4.5:7.13.12| 50453490 CHEMBL2112736 Kappa-type opioid receptor Cavia porcellus 27 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453490 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453490&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71452702 225145960 CHEMBL2112736 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037609 Oc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)C(=O)CC[C@@]35O InChI=1S/C20H23NO4/c22-13-4-3-12-9-15-20(24)6-5-14(23)18-19(20,16(12)17(13)25-18)7-8-21(15)10-11-1-2-11/h3-4,11,15,18,22,24H,1-2,5-10H2 DQCKKXVULJGBQN-UHFFFAOYSA-N 60212 SMR000058767::NALTREXONE HYDROCHLORIDE::MLS000069607::cid_5485201::(4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,9-bis(oxidanyl)-2,4,5,6,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-one;hydrochloride::(4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,9-dihydroxy-2,4,5,6,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-one;hydrochloride::US9107954, naltrexone::US10988481, Compound NTX::US20240208984, Compound Naltrexone Mu-type opioid receptor Cavia porcellus 0.230000 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=60212 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=60212&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5360515 252639834 DB00704 C07253 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037610 Oc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)C(=O)CC[C@@]35O InChI=1S/C20H23NO4/c22-13-4-3-12-9-15-20(24)6-5-14(23)18-19(20,16(12)17(13)25-18)7-8-21(15)10-11-1-2-11/h3-4,11,15,18,22,24H,1-2,5-10H2 DQCKKXVULJGBQN-UHFFFAOYSA-N 60212 SMR000058767::NALTREXONE HYDROCHLORIDE::MLS000069607::cid_5485201::(4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,9-bis(oxidanyl)-2,4,5,6,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-one;hydrochloride::(4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,9-dihydroxy-2,4,5,6,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-one;hydrochloride::US9107954, naltrexone::US10988481, Compound NTX::US20240208984, Compound Naltrexone Delta-type opioid receptor Homo sapiens 10 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=60212 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=60212&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5360515 252639834 DB00704 C07253 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037611 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1ccc2ccccc2c1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453481 CHEMBL2111911 Delta-type opioid receptor Homo sapiens 20 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453481&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71454425 225145951 CHEMBL2111911 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037612 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1cccc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453483 CHEMBL2111912 Delta-type opioid receptor Homo sapiens 6.6 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453483 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453483&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456180 225145953 CHEMBL2111912 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037613 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1ccc(cc1)-c1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453484 CHEMBL2111913 Delta-type opioid receptor Homo sapiens 19 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453484 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453484&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71457978 225145954 CHEMBL2111913 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037614 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453485 CHEMBL2111914 Delta-type opioid receptor Homo sapiens 1.4 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453485 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453485&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456181 225145955 CHEMBL2111914 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037615 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1cccc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453486 CHEMBL2112740 Mu-type opioid receptor Cavia porcellus 3.1 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453486 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453486&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71454482 225145956 CHEMBL2112740 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037616 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1c2ccccc2cc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:8:7:22:18.4.5,17:18:22:7.13.12,21:22:18.4.5:7.13.12| 50453487 CHEMBL2111916 Mu-type opioid receptor Cavia porcellus 6.6 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453487 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453487&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456182 225145957 CHEMBL2111916 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037617 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1c2ccccc2cc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:8:7:22:18.4.5,17:18:22:7.13.12,21:22:18.4.5:7.13.12| 50453487 CHEMBL2111916 Delta-type opioid receptor Homo sapiens 36 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453487 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453487&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456182 225145957 CHEMBL2111916 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037618 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453485 CHEMBL2111914 Mu-type opioid receptor Cavia porcellus 0.300000 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453485 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453485&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456181 225145955 CHEMBL2111914 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037619 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1ccc(cc1)-c1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453484 CHEMBL2111913 Mu-type opioid receptor Cavia porcellus 10 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453484 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453484&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71457978 225145954 CHEMBL2111913 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037620 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1c2ccccc2cc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:8:7:22:18.4.5,17:18:22:7.13.12,21:22:18.4.5:7.13.12| 50453487 CHEMBL2111916 Kappa-type opioid receptor Cavia porcellus 34 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453487 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453487&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456182 225145957 CHEMBL2111916 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037621 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1ccc(cc1)-c1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453484 CHEMBL2111913 Kappa-type opioid receptor Cavia porcellus 12 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453484 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453484&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71457978 225145954 CHEMBL2111913 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037622 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453485 CHEMBL2111914 Kappa-type opioid receptor Cavia porcellus 0.600000 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453485 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453485&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456181 225145955 CHEMBL2111914 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037623 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1ccc2ccccc2c1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453481 CHEMBL2111911 Kappa-type opioid receptor Cavia porcellus 1.4 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453481&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71454425 225145951 CHEMBL2111911 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037624 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1cccc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453486 CHEMBL2112740 Delta-type opioid receptor Homo sapiens 5.5 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453486 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453486&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71454482 225145956 CHEMBL2112740 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037625 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1cccc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453486 CHEMBL2112740 Kappa-type opioid receptor Cavia porcellus 6.1 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453486 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453486&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71454482 225145956 CHEMBL2112740 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037626 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@H](CCC35O)OCc1cccc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453483 CHEMBL2111912 Kappa-type opioid receptor Cavia porcellus 4.4 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453483 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453483&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456180 225145953 CHEMBL2111912 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037627 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)C(CCC35O)OCC(=O)C1[C@H]2C[C@@H]3C[C@@H](C[C@H]1C3)C2 |wU:33.44,31.36,35.40,wD:29.45,TLB:26:28:34:31.36.32,23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,30:29:34:31.36.32,30:31:29.28.37:34,21:22:18.4.5:7.13.12,8:7:22:18.4.5,(4.96,-10.23,;3.61,-9.46,;2.28,-10.23,;.94,-9.46,;.94,-7.89,;-.38,-7.15,;-.38,-5.61,;-1.73,-5.25,;-3.04,-4.5,;-3.06,-2.96,;-2.3,-1.62,;-3.85,-1.62,;-.63,-6.35,;.72,-5.61,;2.26,-5.61,;3.71,-5.15,;4.61,-6.37,;3.61,-7.89,;2.28,-7.14,;5.32,-4.45,;3.81,-4.06,;2.49,-4.84,;.94,-4.86,;.53,-3.36,;6.64,-3.68,;7.98,-4.42,;9.5,-3.9,;10.14,-5.19,;10.58,-2.78,;12.04,-2.28,;13.49,-2.78,;14.44,-1.45,;14.38,.1,;12.94,.6,;11.62,.05,;11.71,-1.43,;13.06,-1.87,;11.96,-.69,)| 50038293 17-(cyclopropylmethyl)-4,5alpha-epoxy-3,14-dihydroxy-6beta-morphinanyl 2-adamantyl-2-oxoethylether::CHEMBL423341 Delta-type opioid receptor Homo sapiens 30 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50038293 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50038293&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44356181 103945730 CHEMBL423341 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037628 CC1(C)SSC(C)(C)[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(=O)NCC(=O)N[C@H](Cc2ccccc2)C(=O)N[C@H]1C(O)=O InChI=1S/C30H39N5O7S2/c1-29(2)23(34-25(38)20(31)14-18-10-12-19(36)13-11-18)27(40)32-16-22(37)33-21(15-17-8-6-5-7-9-17)26(39)35-24(28(41)42)30(3,4)44-43-29/h5-13,20-21,23-24,36H,14-16,31H2,1-4H3,(H,32,40)(H,33,37)(H,34,38)(H,35,39)(H,41,42) MCMMCRYPQBNCPH-UHFFFAOYSA-N 50001683 CHEMBL294616::13-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-7-benzyl-3,3,14,14-tetramethyl-6,9,12-trioxo-1,2-dithia-5,8,11-triaza-cyclotetradecane-4-carboxylic acid::DPDPE::7-Benzyl-10-{[3-(4-hydroxy-phenyl)-pyrrolidine-2-carbonyl]-amino}-3,3-dimethyl-6,9-dioxo-1,2-dithia-5,8-diaza-cycloundecane-4-carboxylic acid Kappa-type opioid receptor Cavia porcellus 2.1 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001683 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001683&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44299404 103916113 CHEMBL294616 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50037629 O[C@@H]1CC[C@@]2(O)[C@H]3Cc4ccc(O)c5O[C@@H]1[C@]2(CCN3CC1CC1)c45 |r| InChI=1S/C20H25NO4/c22-13-4-3-12-9-15-20(24)6-5-14(23)18-19(20,16(12)17(13)25-18)7-8-21(15)10-11-1-2-11/h3-4,11,14-15,18,22-24H,1-2,5-10H2 JLVNEHKORQFVQJ-UHFFFAOYSA-N 50001709 CHEMBL558140::CHEMBL140278::4-cyclopropylmethyl-(13R)-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7,9,11(18)-triene-10,14,17-triol::Naltrexone-6-beta-ol Delta-type opioid receptor Homo sapiens 26 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001709 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2100&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001709&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5486554 103916124 CHEMBL140278CHEMBL558140 1 MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA 8Y71,4RWD,4RWA Delta-type opioid receptor OPRD_HUMAN P41143 B5B0B8 50037633 O[C@@H]1CC[C@@]2(O)[C@H]3Cc4ccc(O)c5O[C@@H]1[C@]2(CCN3CC1CC1)c45 |r| InChI=1S/C20H25NO4/c22-13-4-3-12-9-15-20(24)6-5-14(23)18-19(20,16(12)17(13)25-18)7-8-21(15)10-11-1-2-11/h3-4,11,14-15,18,22-24H,1-2,5-10H2 JLVNEHKORQFVQJ-UHFFFAOYSA-N 50001709 CHEMBL558140::CHEMBL140278::4-cyclopropylmethyl-(13R)-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7,9,11(18)-triene-10,14,17-triol::Naltrexone-6-beta-ol Mu-type opioid receptor Cavia porcellus 0.500000 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001709 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001709&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5486554 103916124 CHEMBL140278CHEMBL558140 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037634 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1c2ccccc2cc2ccccc12 |r,TLB:23:22:18.4.5:7.13.12,THB:8:7:22:18.4.5,17:18:22:7.13.12,21:22:18.4.5:7.13.12| 50453490 CHEMBL2112736 Mu-type opioid receptor Cavia porcellus 16 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453490 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453490&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71452702 225145960 CHEMBL2112736 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037635 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453488 CHEMBL2112732 Mu-type opioid receptor Cavia porcellus 2.4 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453488 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453488&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456227 225145958 CHEMBL2112732 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037636 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1ccc2ccccc2c1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453482 CHEMBL2112729 Mu-type opioid receptor Cavia porcellus 1.7 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453482 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453482&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456225 225145952 CHEMBL2112729 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266 50037637 Oc1ccc2CC3N(CC4CC4)CCC45C(Oc1c24)[C@@H](CCC35O)OCc1ccc(cc1)-c1ccccc1 |r,TLB:23:22:18.4.5:7.13.12,THB:17:18:22:7.13.12,21:22:18.4.5:7.13.12,8:7:22:18.4.5| 50453489 CHEMBL2112730 Mu-type opioid receptor Cavia porcellus 0.700000 ChEMBL 10.1021/jm00051a003 10.7270/Q2NV9JVC 7996538 Nelson, TD; Davis, RD; Nelson, WL 1/13/1995 10/28/2012 University of Washington http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50453489 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000882&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50453489&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71454481 225145959 CHEMBL2112730 1 YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI Mu-type opioid receptor OPRM_CAVPO P97266