BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50036803 C[N+]1(C)CCC2(CC1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |w:9.10| InChI=1S/C23H25NO2/c1-24(2)12-11-23(18-9-6-10-19(25)14-18)15-21(24)20(22(26)16-23)13-17-7-4-3-5-8-17/h3-10,13-14,21H,11-12,15-16H2,1-2H3/p+1 RUNCJSVSZYLOGZ-UHFFFAOYSA-O 50037188 5-(3-Hydroxy-phenyl)-2,2-dimethyl-7-oxo-8-[1-phenyl-meth-(E)-ylidene]-2-azonia-bicyclo[3.3.1]nonane; iodide::CHEMBL109160 Kappa-type opioid receptor Cavia porcellus >5000 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50037188 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50037188&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44337610 103944766 CHEMBL109160 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50036804 COc1cccc(c1)[C@]12CCN(C)[C@H](CC(=O)C1)C2 |r| InChI=1S/C16H21NO2/c1-17-7-6-16(10-13(17)9-14(18)11-16)12-4-3-5-15(8-12)19-2/h3-5,8,13H,6-7,9-11H2,1-2H3 RMXPANLFBPCCIX-UHFFFAOYSA-N 50407212 CHEMBL2111686 Delta-type opioid receptor Rattus norvegicus 505 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407212 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3138&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407212&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456164 163356236 CHEMBL2111686 1 MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA 8Y45 Delta-type opioid receptor OPRD_RAT P33533 50036805 CN1CC[C@@]2(C[C@H]1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |r,w:8.9| InChI=1S/C22H23NO2/c1-23-11-10-22(17-8-5-9-18(24)13-17)14-20(23)19(21(25)15-22)12-16-6-3-2-4-7-16/h2-9,12-13,20,24H,10-11,14-15H2,1H3 YVMTWTZIAIUURI-UHFFFAOYSA-N 50407211 CHEMBL2111684 Delta-type opioid receptor Rattus norvegicus 1980 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407211 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3138&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407211&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 10449500 163356235 CHEMBL2111684 1 MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA 8Y45 Delta-type opioid receptor OPRD_RAT P33533 50036806 CN1CC[C@@]2(C[C@H]1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |r,w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50407213 CHEMBL2111685 Delta-type opioid receptor Rattus norvegicus >500 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407213 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3138&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407213&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5468876 163356237 CHEMBL2111685 1 MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA 8Y45 Delta-type opioid receptor OPRD_RAT P33533 50036807 CN1CCC2(CC1CC(=O)C2)c1cccc(O)c1 InChI=1S/C15H19NO2/c1-16-6-5-15(9-12(16)8-14(18)10-15)11-3-2-4-13(17)7-11/h2-4,7,12,17H,5-6,8-10H2,1H3 CHWUTFJMLXHAEH-UHFFFAOYSA-N 50029783 5-(3-Hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL38791 Delta-type opioid receptor Rattus norvegicus 121 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029783 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3138&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029783&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44285482 103938803 CHEMBL38791 1 MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA 8Y45 Delta-type opioid receptor OPRD_RAT P33533 50036808 CN1CC[C@@]2(C[C@@H]1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50407214 CHEMBL2008608 Kappa-type opioid receptor Cavia porcellus >500 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407214 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407214&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 45489962 163356238 CHEMBL2008608 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50036809 CN1CCC2(CC1CC(=O)C2)c1cccc(O)c1 InChI=1S/C15H19NO2/c1-16-6-5-15(9-12(16)8-14(18)10-15)11-3-2-4-13(17)7-11/h2-4,7,12,17H,5-6,8-10H2,1H3 CHWUTFJMLXHAEH-UHFFFAOYSA-N 50029783 5-(3-Hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL38791 Mu-type opioid receptor Rattus norvegicus 8.7 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029783 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2101&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029783&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44285482 103938803 CHEMBL38791 1 MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP 4DKL Mu-type opioid receptor OPRM_RAT P33535 Q2TV20 Q2TV21 Q4VWM5 Q4VWM7 Q4VWX7 Q4VWX8 Q62846 Q64064 Q64120 50036810 CN1CC[C@@]2(C[C@H]1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |r,w:8.9| InChI=1S/C22H23NO2/c1-23-11-10-22(17-8-5-9-18(24)13-17)14-20(23)19(21(25)15-22)12-16-6-3-2-4-7-16/h2-9,12-13,20,24H,10-11,14-15H2,1H3 YVMTWTZIAIUURI-UHFFFAOYSA-N 50407211 CHEMBL2111684 Mu-type opioid receptor Rattus norvegicus 392 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407211 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2101&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407211&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 10449500 163356235 CHEMBL2111684 1 MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP 4DKL Mu-type opioid receptor OPRM_RAT P33535 Q2TV20 Q2TV21 Q4VWM5 Q4VWM7 Q4VWX7 Q4VWX8 Q62846 Q64064 Q64120 50036811 CN1CCC2(CC1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H23NO2/c1-23-11-10-22(17-8-5-9-18(24)13-17)14-20(23)19(21(25)15-22)12-16-6-3-2-4-7-16/h2-9,12-13,20,24H,10-11,14-15H2,1H3 YVMTWTZIAIUURI-UHFFFAOYSA-N 50029782 5-(3-Hydroxy-phenyl)-2-methyl-8-[1-phenyl-meth-(E)-ylidene]-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL110319 Kappa-type opioid receptor Cavia porcellus 576 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029782 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029782&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5478726 103938802 CHEMBL110319 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50036812 CN1CC[C@@]2(C[C@H]1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |r,w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50407213 CHEMBL2111685 Mu-type opioid receptor Rattus norvegicus 45 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407213 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2101&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407213&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5468876 163356237 CHEMBL2111685 1 MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP 4DKL Mu-type opioid receptor OPRM_RAT P33535 Q2TV20 Q2TV21 Q4VWM5 Q4VWM7 Q4VWX7 Q4VWX8 Q62846 Q64064 Q64120 50036813 CN1CCC2(CC1CC(=O)C2)c1cccc(O)c1 InChI=1S/C15H19NO2/c1-16-6-5-15(9-12(16)8-14(18)10-15)11-3-2-4-13(17)7-11/h2-4,7,12,17H,5-6,8-10H2,1H3 CHWUTFJMLXHAEH-UHFFFAOYSA-N 50029783 5-(3-Hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL38791 Sigma non-opioid intracellular receptor 1 Homo sapiens 31800 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029783 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029783&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44285482 103938803 CHEMBL38791 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50036814 COc1cccc(c1)[C@]12CCN(C)[C@H](CC(=O)C1)C2 |r| InChI=1S/C16H21NO2/c1-17-7-6-16(10-13(17)9-14(18)11-16)12-4-3-5-15(8-12)19-2/h3-5,8,13H,6-7,9-11H2,1-2H3 RMXPANLFBPCCIX-UHFFFAOYSA-N 50407212 CHEMBL2111686 Mu-type opioid receptor Rattus norvegicus 36 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407212 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2101&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407212&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456164 163356236 CHEMBL2111686 1 MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP 4DKL Mu-type opioid receptor OPRM_RAT P33535 Q2TV20 Q2TV21 Q4VWM5 Q4VWM7 Q4VWX7 Q4VWX8 Q62846 Q64064 Q64120 50036815 CN1CC[C@@]2(C[C@@H]1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50407214 CHEMBL2008608 Delta-type opioid receptor Rattus norvegicus 271 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407214 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3138&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407214&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 45489962 163356238 CHEMBL2008608 1 MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA 8Y45 Delta-type opioid receptor OPRD_RAT P33533 50036816 CN1CC[C@@]2(C[C@@H]1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50407214 CHEMBL2008608 Mu-type opioid receptor Rattus norvegicus 4.5 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407214 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2101&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407214&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 45489962 163356238 CHEMBL2008608 1 MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP 4DKL Mu-type opioid receptor OPRM_RAT P33535 Q2TV20 Q2TV21 Q4VWM5 Q4VWM7 Q4VWX7 Q4VWX8 Q62846 Q64064 Q64120 50036819 CN1CC[C@@]2(C[C@H]1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |r,w:8.9| InChI=1S/C22H23NO2/c1-23-11-10-22(17-8-5-9-18(24)13-17)14-20(23)19(21(25)15-22)12-16-6-3-2-4-7-16/h2-9,12-13,20,24H,10-11,14-15H2,1H3 YVMTWTZIAIUURI-UHFFFAOYSA-N 50407211 CHEMBL2111684 Sigma non-opioid intracellular receptor 1 Homo sapiens 9.4 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407211 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407211&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10449500 163356235 CHEMBL2111684 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50036821 CN1CC[C@@]2(C[C@H]1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |r,w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50407213 CHEMBL2111685 Kappa-type opioid receptor Cavia porcellus >500 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407213 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407213&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5468876 163356237 CHEMBL2111685 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50036822 COc1cccc(c1)[C@]12CCN(C)[C@H](CC(=O)C1)C2 |r| InChI=1S/C16H21NO2/c1-17-7-6-16(10-13(17)9-14(18)11-16)12-4-3-5-15(8-12)19-2/h3-5,8,13H,6-7,9-11H2,1-2H3 RMXPANLFBPCCIX-UHFFFAOYSA-N 50407212 CHEMBL2111686 Kappa-type opioid receptor Cavia porcellus 2536 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407212 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407212&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 71456164 163356236 CHEMBL2111686 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50036823 CN1CCC2(CC1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50029788 8-[1-(3,4-Dichloro-phenyl)-meth-(E)-ylidene]-5-(3-hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL322468 Kappa-type opioid receptor Cavia porcellus >500 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029788 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029788&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 6273133 103938808 CHEMBL322468 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50036824 CN1CC[C@@]2(C[C@H]1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |r,w:8.9| InChI=1S/C22H23NO2/c1-23-11-10-22(17-8-5-9-18(24)13-17)14-20(23)19(21(25)15-22)12-16-6-3-2-4-7-16/h2-9,12-13,20,24H,10-11,14-15H2,1H3 YVMTWTZIAIUURI-UHFFFAOYSA-N 50407211 CHEMBL2111684 Kappa-type opioid receptor Cavia porcellus 889 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407211 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407211&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 10449500 163356235 CHEMBL2111684 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50036826 CN1CCC2(CC1CC(=O)C2)c1cccc(O)c1 InChI=1S/C15H19NO2/c1-16-6-5-15(9-12(16)8-14(18)10-15)11-3-2-4-13(17)7-11/h2-4,7,12,17H,5-6,8-10H2,1H3 CHWUTFJMLXHAEH-UHFFFAOYSA-N 50029783 5-(3-Hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL38791 Kappa-type opioid receptor Cavia porcellus 491 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029783 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2124&target=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029783&enzyme=Kappa-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44285482 103938803 CHEMBL38791 1 MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRVRNTVQDPAYMRNVDGVNKPV Kappa-type opioid receptor OPRK_CAVPO P41144 50057983 C[N+]1(C)CCC2(CC1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |w:9.10| InChI=1S/C23H25NO2/c1-24(2)12-11-23(18-9-6-10-19(25)14-18)15-21(24)20(22(26)16-23)13-17-7-4-3-5-8-17/h3-10,13-14,21H,11-12,15-16H2,1-2H3/p+1 RUNCJSVSZYLOGZ-UHFFFAOYSA-O 50037188 5-(3-Hydroxy-phenyl)-2,2-dimethyl-7-oxo-8-[1-phenyl-meth-(E)-ylidene]-2-azonia-bicyclo[3.3.1]nonane; iodide::CHEMBL109160 Mu-type opioid receptor Rattus norvegicus >700 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50037188 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2101&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50037188&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44337610 103944766 CHEMBL109160 1 MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP 4DKL Mu-type opioid receptor OPRM_RAT P33535 Q2TV20 Q2TV21 Q4VWM5 Q4VWM7 Q4VWX7 Q4VWX8 Q62846 Q64064 Q64120 50057984 COc1cccc(c1)C12CCN(C)C(C1)C(=Cc1ccccc1)C(=O)C2 |w:16.18| InChI=1S/C23H25NO2/c1-24-12-11-23(18-9-6-10-19(14-18)26-2)15-21(24)20(22(25)16-23)13-17-7-4-3-5-8-17/h3-10,13-14,21H,11-12,15-16H2,1-2H3 QZJJWXHOVZHRTH-UHFFFAOYSA-N 50029790 5-(3-Methoxy-phenyl)-2-methyl-8-[1-phenyl-meth-(E)-ylidene]-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL109124 Sigma non-opioid intracellular receptor 1 Homo sapiens 137.7 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029790 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029790&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10641401 103938810 CHEMBL109124 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50057985 CN1CCC2(CC1CC(=O)C2)c1cccc(O)c1 InChI=1S/C15H19NO2/c1-16-6-5-15(9-12(16)8-14(18)10-15)11-3-2-4-13(17)7-11/h2-4,7,12,17H,5-6,8-10H2,1H3 CHWUTFJMLXHAEH-UHFFFAOYSA-N 50029783 5-(3-Hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL38791 Sigma non-opioid intracellular receptor 1 Homo sapiens 31800 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029783 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029783&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44285482 103938803 CHEMBL38791 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50057987 C[N+]1(C)CCC2(CC1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |w:9.10| InChI=1S/C23H25NO2/c1-24(2)12-11-23(18-9-6-10-19(25)14-18)15-21(24)20(22(26)16-23)13-17-7-4-3-5-8-17/h3-10,13-14,21H,11-12,15-16H2,1-2H3/p+1 RUNCJSVSZYLOGZ-UHFFFAOYSA-O 50037188 5-(3-Hydroxy-phenyl)-2,2-dimethyl-7-oxo-8-[1-phenyl-meth-(E)-ylidene]-2-azonia-bicyclo[3.3.1]nonane; iodide::CHEMBL109160 Delta-type opioid receptor Rattus norvegicus >1000 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50037188 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3138&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50037188&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44337610 103944766 CHEMBL109160 1 MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA 8Y45 Delta-type opioid receptor OPRD_RAT P33533 50057993 CN1CCC2(CC1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H23NO2/c1-23-11-10-22(17-8-5-9-18(24)13-17)14-20(23)19(21(25)15-22)12-16-6-3-2-4-7-16/h2-9,12-13,20,24H,10-11,14-15H2,1H3 YVMTWTZIAIUURI-UHFFFAOYSA-N 50029782 5-(3-Hydroxy-phenyl)-2-methyl-8-[1-phenyl-meth-(E)-ylidene]-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL110319 Mu-type opioid receptor Rattus norvegicus 33.9 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029782 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2101&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029782&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5478726 103938802 CHEMBL110319 1 MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP 4DKL Mu-type opioid receptor OPRM_RAT P33535 Q2TV20 Q2TV21 Q4VWM5 Q4VWM7 Q4VWX7 Q4VWX8 Q62846 Q64064 Q64120 50057994 CN1CCC2(CC1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H23NO2/c1-23-11-10-22(17-8-5-9-18(24)13-17)14-20(23)19(21(25)15-22)12-16-6-3-2-4-7-16/h2-9,12-13,20,24H,10-11,14-15H2,1H3 YVMTWTZIAIUURI-UHFFFAOYSA-N 50029782 5-(3-Hydroxy-phenyl)-2-methyl-8-[1-phenyl-meth-(E)-ylidene]-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL110319 Sigma non-opioid intracellular receptor 1 Homo sapiens 23.3 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029782 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029782&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 5478726 103938802 CHEMBL110319 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50057999 COc1cccc(c1)C12CCN(C)C(CC(=O)C1)C2 InChI=1S/C16H21NO2/c1-17-7-6-16(10-13(17)9-14(18)11-16)12-4-3-5-15(8-12)19-2/h3-5,8,13H,6-7,9-11H2,1-2H3 RMXPANLFBPCCIX-UHFFFAOYSA-N 50037189 5-(3-Methoxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL322329 Sigma non-opioid intracellular receptor 1 Homo sapiens 5200 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50037189 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50037189&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15601069 103944767 CHEMBL322329 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50058002 CN1CCC2(CC1CC(=O)C2)c1cccc(O)c1 InChI=1S/C15H19NO2/c1-16-6-5-15(9-12(16)8-14(18)10-15)11-3-2-4-13(17)7-11/h2-4,7,12,17H,5-6,8-10H2,1H3 CHWUTFJMLXHAEH-UHFFFAOYSA-N 50029783 5-(3-Hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL38791 Delta-type opioid receptor Rattus norvegicus 121.5 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029783 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3138&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029783&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44285482 103938803 CHEMBL38791 1 MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA 8Y45 Delta-type opioid receptor OPRD_RAT P33533 50058016 CN1CCC2(CC1CC(=O)C2)c1cccc(O)c1 InChI=1S/C15H19NO2/c1-16-6-5-15(9-12(16)8-14(18)10-15)11-3-2-4-13(17)7-11/h2-4,7,12,17H,5-6,8-10H2,1H3 CHWUTFJMLXHAEH-UHFFFAOYSA-N 50029783 5-(3-Hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL38791 Mu-type opioid receptor Rattus norvegicus 8.70 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029783 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2101&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029783&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 44285482 103938803 CHEMBL38791 1 MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP 4DKL Mu-type opioid receptor OPRM_RAT P33535 Q2TV20 Q2TV21 Q4VWM5 Q4VWM7 Q4VWX7 Q4VWX8 Q62846 Q64064 Q64120 50058021 CN1CCC2(CC1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50029788 8-[1-(3,4-Dichloro-phenyl)-meth-(E)-ylidene]-5-(3-hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL322468 Sigma non-opioid intracellular receptor 1 Homo sapiens 65.3 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029788 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029788&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 6273133 103938808 CHEMBL322468 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50058036 CN1CCC2(CC1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50029788 8-[1-(3,4-Dichloro-phenyl)-meth-(E)-ylidene]-5-(3-hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL322468 Delta-type opioid receptor Rattus norvegicus 240.4 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029788 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3138&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029788&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 6273133 103938808 CHEMBL322468 1 MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA 8Y45 Delta-type opioid receptor OPRD_RAT P33533 50058037 CN1CCC2(CC1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50029788 8-[1-(3,4-Dichloro-phenyl)-meth-(E)-ylidene]-5-(3-hydroxy-phenyl)-2-methyl-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL322468 Mu-type opioid receptor Rattus norvegicus 6.1 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029788 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2101&target=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029788&enzyme=Mu-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 6273133 103938808 CHEMBL322468 1 MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP 4DKL Mu-type opioid receptor OPRM_RAT P33535 Q2TV20 Q2TV21 Q4VWM5 Q4VWM7 Q4VWX7 Q4VWX8 Q62846 Q64064 Q64120 50058039 CN1CCC2(CC1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H23NO2/c1-23-11-10-22(17-8-5-9-18(24)13-17)14-20(23)19(21(25)15-22)12-16-6-3-2-4-7-16/h2-9,12-13,20,24H,10-11,14-15H2,1H3 YVMTWTZIAIUURI-UHFFFAOYSA-N 50029782 5-(3-Hydroxy-phenyl)-2-methyl-8-[1-phenyl-meth-(E)-ylidene]-2-aza-bicyclo[3.3.1]nonan-7-one::CHEMBL110319 Delta-type opioid receptor Rattus norvegicus >500 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029782 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3138&target=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029782&enzyme=Delta-type+opioid+receptor&column=ki&startPg=0&Increment=50&submit=Search 5478726 103938802 CHEMBL110319 1 MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA 8Y45 Delta-type opioid receptor OPRD_RAT P33533 50058043 C[N+]1(C)CCC2(CC1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |w:9.10| InChI=1S/C23H25NO2/c1-24(2)12-11-23(18-9-6-10-19(25)14-18)15-21(24)20(22(26)16-23)13-17-7-4-3-5-8-17/h3-10,13-14,21H,11-12,15-16H2,1-2H3/p+1 RUNCJSVSZYLOGZ-UHFFFAOYSA-O 50037188 5-(3-Hydroxy-phenyl)-2,2-dimethyl-7-oxo-8-[1-phenyl-meth-(E)-ylidene]-2-azonia-bicyclo[3.3.1]nonane; iodide::CHEMBL109160 Sigma non-opioid intracellular receptor 1 Homo sapiens 5400 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50037188 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50037188&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44337610 103944766 CHEMBL109160 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50992513 COc1cccc(c1)[C@]12CCN(C)[C@H](CC(=O)C1)C2 |r| InChI=1S/C16H21NO2/c1-17-7-6-16(10-13(17)9-14(18)11-16)12-4-3-5-15(8-12)19-2/h3-5,8,13H,6-7,9-11H2,1-2H3 RMXPANLFBPCCIX-UHFFFAOYSA-N 50407212 CHEMBL2111686 Sigma non-opioid intracellular receptor 1 Homo sapiens 762.3 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407212 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407212&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71456164 163356236 CHEMBL2111686 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50992514 CN1CC[C@@]2(C[C@H]1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |r,w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50407213 CHEMBL2111685 Sigma non-opioid intracellular receptor 1 Homo sapiens 32 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407213 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407213&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 5468876 163356237 CHEMBL2111685 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50992515 CN1CC[C@@]2(C[C@H]1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |r,w:8.9| InChI=1S/C22H23NO2/c1-23-11-10-22(17-8-5-9-18(24)13-17)14-20(23)19(21(25)15-22)12-16-6-3-2-4-7-16/h2-9,12-13,20,24H,10-11,14-15H2,1H3 YVMTWTZIAIUURI-UHFFFAOYSA-N 50407211 CHEMBL2111684 Sigma non-opioid intracellular receptor 1 Homo sapiens 9.4 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407211 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407211&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10449500 163356235 CHEMBL2111684 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50992516 CN1CC[C@@]2(C[C@@H]1C(=Cc1ccc(Cl)c(Cl)c1)C(=O)C2)c1cccc(O)c1 |w:8.9| InChI=1S/C22H21Cl2NO2/c1-25-8-7-22(15-3-2-4-16(26)11-15)12-20(25)17(21(27)13-22)9-14-5-6-18(23)19(24)10-14/h2-6,9-11,20,26H,7-8,12-13H2,1H3 SSPWSCFMVXPMNL-UHFFFAOYSA-N 50407214 CHEMBL2008608 Sigma non-opioid intracellular receptor 1 Homo sapiens 3200 ChEMBL 10.1021/jm00045a022 10.7270/Q2F18XSH 7932540 Bertha, CM; Mattson, MV; Flippen-Anderson, JL; Rothman, RB; Xu, H; Cha, XY; Becketts, K; Rice, KC 10/27/1994 11/10/2009 National Institute of Diabetes and Digestive and Kidney Diseases http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407214 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407214&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 45489962 163356238 CHEMBL2008608 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0